KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011006Help
Entry
AaeL_AAEL011006   CDS       T01053                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AaeL_AAEL011006
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AaeL_AAEL011006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 232 aa AA seqDB search
MLTLTVVIAKAFSQLSGMVKQGPRPLVICGPSGSGKSTLLKKLFKEFPETFGFSVSHTTR
KPRPGEENGVHYHFVSVEEMQAAIENGEFIETAVFSGNMYGTSKKAVENVQQQGKVCVLD
IEIEGVKQVRNSDRLNPLLVFVNPPSVAELERRLRGRQTETEESLQKRLNTARVEIEYGS
TPGNFDIVVHNNNLKQAYADLRDFIVRELETQQNQDNFFISSIITGYKGYEV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcttacactaacagtcgtgattgccaaggcattttcgcaactttccggaatggttaag
caaggtccacgtccgctcgtaatctgcggcccgtccgggtccggcaagagcaccctgctg
aagaagctgttcaaggaattccccgaaacgtttggattcagcgtgtcgcacaccacccga
aagccaagacccggagaggagaacggcgtgcactatcactttgtctctgtggaagaaatg
caggccgccatcgaaaacggagagttcatcgaaactgccgtttttagtgggaacatgtat
ggcacgagtaaaaaagcagtggaaaatgtgcaacaacagggtaaggtgtgcgtgttggac
atcgaaatcgaaggagtcaaacaggtgcgcaattccgatcggttaaacccgctgctggtg
tttgtcaatcctccctcggtggcggaactcgagcgcagacttcgcggtcgtcagactgag
acagaggagagcttacagaagcgtctgaatacggcgcgggttgaaattgagtatggttcc
actccgggcaacttcgacatcgtggtccacaataacaacttgaagcaagcgtacgccgat
ctgcgggacttcatcgtccgggagctggaaacccaacagaatcaagacaacttcttcata
tcttccataatcacaggatataaaggctatgaagtgtaa

DBGET integrated database retrieval system