KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011106Help
Entry
AaeL_AAEL011106   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AaeL_AAEL011106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 877 aa AA seqDB search
MRENSEDVSPQVWKEWILEAIRRIRCQKQRPSVQRICQAIGSHHKFHEDIVAEKLEEAVE
AGSVLKVYNKGLHSYKAPTNTQRRVLLVTNDSDLSRLVVKAVRDLGECDGSSLKSIENYV
QQTNNLNISSGTDFGLVIKNSIRIASEEGSLLQEAKLYKLGSLDKPLIRRKSSSPKKKDK
ILNEASTKKTTNIVCVECLGTEAKGPSGLPEPLSSCNGCGMSLHNKCANGDDTTVPLAAL
VKKGNKWYCEECKSCDACSTQNEKGPCVLSCNYCLKNFHFSCMDPAIVDSKKLKSVWRCS
SCMALYSQNIKSEMESTPQPKKRHETDREEKKKKRSLHETPSMLRNMTSPVQGSSSASVK
TPKACSSSKNNNQRRIKQQQSQLSSPEPAERIEELPDTSSASDEDVAKRFKYRHSRGKES
SKVYDANCRAVHLSESSSESSSSNNELHNYTTSDSCSSSSDSTNDSEDSESSETEEPTVV
KGTKNDDSSQHFWPGINSQLGLLSVAPQIGIHNQKTAMPFVGSTMNASESWGFAAEAKKN
IDIFRQTTNPAITKSDSKPSGVIFKKVEQPAKQEKDKVKTTDNLMQSPNNTVRSAEKKNS
LQSTSTSDPRSNKKLSKESKAIHGSYDQRLMIKRKQIESTAKHDNKKGSEACSKNTILSQ
CFFSFTPILEQPPLPNGVTQKDADLYKQVRNQAANSLAEMMRLDAKVFTKDVTPEPNTSP
SKKAALAAALQSPSKFMAAQERCPAAIEFGKYEIQTWYSSPFPQEYARLPKLFLCEFCLK
YTKSKAVLQRHQDKCSWRHPPGTEIYRCNDISIFEVDDKTTLILVYGRIHFQTKIIGHRN
QKKGMGQARSKATLIANKNRNLRVQFILIPVDTKSVL
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaaactcggaagacgtcagccctcaggtgtggaaggagtggattcttgaagca
atacgacgcattcgttgccagaagcagcgtcctagcgttcagaggatctgccaagcaatt
ggtagccaccataaattccatgaggacattgtggcagaaaagctcgaggaagccgttgaa
gctggatcagtgctaaaagtgtataacaaaggactacattcgtataaggcccccacgaac
acccagagacgcgtattgctggtcacgaatgacagtgacttgtcaagactagtggtaaaa
gccgtgcgggaccttggagaatgcgatggatcaagtttgaagtcaatcgaaaactatgtt
cagcagacaaacaatttgaacataagtagcggaacggatttcggcttagtgataaaaaac
tcaatccgtatagcatcggaagaaggaagtcttctgcaggaagctaaactgtacaaactg
ggaagcttggataaacctttgattagaagaaaatcgtcctcaccgaagaaaaaggacaaa
attttgaatgaagcgtcgactaagaaaacaactaacatcgtctgcgtcgaatgtcttggt
acagaagcaaaaggcccttctggactgccagagcctttaagttcgtgtaatggttgtggt
atgtcgttgcataataagtgcgcaaatggagatgatactaccgtaccattggctgcgttg
gtgaaaaaaggcaataaatggtactgtgaggaatgcaaatcatgtgatgcttgttcgacg
caaaacgaaaaaggaccctgtgtacttagttgtaattactgcttgaagaattttcatttc
tcatgcatggaccccgccatcgtcgattctaaaaagctcaaatctgtttggaggtgttct
tcttgcatggctctgtacagtcagaatattaaatcggaaatggaaagcacacctcagcca
aaaaagcgacatgaaacagacagagaagaaaagaagaagaagagatcgttgcatgagact
ccatcgatgctcaggaatatgacgtcgcctgtgcaaggaagctctagtgcttcagtgaaa
actccgaaagcgtgctcttcgtctaaaaataacaatcaacgtcgtatcaaacaacagcag
tcccagctatcatcgccagagcctgcggaacggatcgaggaattgcccgacactagcagt
gcgagcgatgaagatgtcgctaaacgatttaaatatagacatagtcggggaaaagaatcg
tcgaaagtctatgatgctaactgtcgtgccgttcatttgtctgaatcgtcatctgaatcg
agtagcagtaataatgaattacacaactacacgacgagtgacagttgtagttccagttca
gacagtactaatgattctgaagacagtgaaagttctgaaactgaagaaccaaccgtagtg
aaaggtactaaaaatgatgatagcagccaacatttttggccaggcatcaatagtcagctt
ggattactatctgtagcgccacaaattggcattcataatcagaaaactgctatgccattt
gttggcagtacaatgaatgccagtgagtcatggggattcgccgccgaagctaaaaaaaat
attgacatttttagacaaacaacaaacccggcaataacgaaaagtgatagcaaaccatca
ggtgtaatattcaaaaaagttgaacaacctgccaagcaagagaaagataaagtgaagaca
actgacaatttaatgcaatcccctaataataccgttcgttcagctgagaagaaaaatagc
ttacaaagcacttcgacgagtgaccctaggtcaaataaaaagctgtctaaagagtccaaa
gctatccacgggagctacgatcagcgcctgatgataaagcggaaacaaatcgagtccact
gcaaagcatgacaataaaaaaggttcggaagcctgcagtaaaaatactattctaagtcaa
tgtttcttctcttttactcctatattagaacaacctccgttgcccaatggagttacacaa
aaggacgctgatctttacaagcaagtgcgcaaccaggctgccaactcactggcagagatg
atgcgtctcgatgccaaagttttcacgaaggatgtcactcccgagcccaacacgtcgcca
tcaaagaaagcggccctcgccgctgcactgcaatcgccttccaagtttatggccgcccag
gaaagatgcccagctgcgatagaattcggaaaatatgaaatccaaacttggtattctagt
ccatttcctcaggaatacgctagattgccaaagctattcctatgcgagttttgtttaaaa
tacaccaagagcaaggccgttctgcagcgacaccaagacaaatgctcgtggcgacatcca
ccgggaactgaaatctaccgctgcaacgatatttccatctttgaagtggacgataaaact
accctcattcttgtttacggacgaatccactttcaaacaaaaatcataggccatcgaaat
caaaaaaagggaatgggtcaggctagatcgaaagctacattaatcgcaaacaagaatagg
aatttacgtgtacaatttatattaataccagttgatacaaaaagtgtactgtaa

DBGET integrated database retrieval system