KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011118Help
Entry
AaeL_AAEL011118   CDS       T01053                                 

Definition
dual specificity protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AaeL_AAEL011118
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: Other group
  TTK family
   AaeL_AAEL011118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 555 aa AA seqDB search
PKRVSELPPLESESDSDDDNNLNCAILNDSFLLTPSKLKVLKRVPLLDRRQLEKQFSLLT
QSDSRLSKARDSGISSTTSSVLSIADQVTEIEIKPAIKEEVDEVELGKSLREQKIQSPPK
DHLFVTPREKFCHSNARGTSSRAIISTTNRKSRNTLENEFKSQKILFTTPLATGLPRPQM
SANDSLSLSLVDTPIKSKDRPLSPIVEQQRPAKRSTDELFPATPGPEKRLSPAPKEVAPA
AVAPTEDMRPMEQSQTKALPTIAINGKEYQVLKKLGSGGSSSVFLAKLNPTGAECALKLV
NLEGDSSLVEGYLNETKLLAKLQGNENVVALHDYCHLPEANQLFLVMEKGDCDLHKILQN
YRKDIPLYTLMQIWYQMVQCVHYIHDHGVIHLDLKPANFLMVKGRLKLIDFGIASNIAFD
STSIMKFSQAGTFNYISPEALIDTSSECSPANSQPKIKMSKKSDIWSLGCILYLLLYKKT
PFAHIKNIHTKVSTITNPNTVIEYPPLPSYYPPMLLEMLQRCLKYDAKSRASTAELLQYP
FDMVIPLPPSGGTSK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
ccgaaaagggtttccgagctacctccgttggagtcggaatctgactcggatgacgacaat
aatctaaactgcgctattttgaacgattcgttccttttgactccgtcaaaattgaaggtt
ttgaagcgagttccgttgttggacaggaggcaacttgagaagcagttctcgctgcttacc
caaagcgattcccggttatcgaaagcaagagattctggaatcagcagtacgacatcgtca
gtgctttccatcgcagatcaggtgaccgaaatagagatcaagcctgcgatcaaagaggaa
gtggacgaggttgaactgggcaaaagtctacgagagcagaaaattcagtctcctcccaag
gaccacctatttgtgactcctcgggaaaaattctgccacagtaacgcccggggaacgtca
tctcgggcgatcatttcgacgacgaatcgtaaatctcggaacacgttagaaaacgaattc
aaatctcagaagattctctttaccactcccttggctacaggtttgcccaggccgcagatg
agtgcgaacgacagtttgtcgttgtcgctggtggatactccgatcaagtcgaaagacaga
cccttgtccccgatcgtggagcagcaacgaccggcgaaacgctctacagacgaactgttc
ccggccactcctggtccggagaagcgactatcgccagcaccaaaggaagttgcaccagcc
gccgtagccccaacggaagatatgcgaccgatggagcaatcgcaaacgaaagctcttccc
acgatagccatcaatgggaaggaataccaggtgctgaagaaattgggctccggtggatcc
agttctgtgtttctcgccaagctgaacccaaccggtgccgagtgtgcgctcaagctggtc
aatctcgaaggtgattccagtctcgtggagggctatttaaacgagacaaagcttttggcc
aaattacaaggaaacgaaaatgtagtggcgctccacgattattgccaccttccggaagcg
aaccaactgttcctcgtcatggagaagggagactgcgatttgcacaaaatcctccaaaac
taccgcaaggacatccccctgtacacgctgatgcagatttggtaccaaatggtgcagtgc
gtgcactacattcacgaccatggagtcatccaccttgatctcaaaccggccaatttcctc
atggtcaagggacggctcaagctgatcgatttcggcattgccagcaacattgccttcgat
tccactagtattatgaagttctctcaggccggcacgttcaactacatcagtccggaggca
ttgattgacacttcgtcggagtgcagcccggccaattcgcaacccaagatcaagatgtcg
aaaaagtccgacatctggtcgctcgggtgcatactgtatctgctcctgtacaaaaagacg
ccctttgcccacatcaagaacatccacaccaaggtaagcaccatcacaaatcccaacacg
gtgattgaataccctccgctgcccagttactatccgcccatgttgctggagatgctgcag
aggtgcctcaagtacgacgccaaatcgagagcgtccacggcggaactgctgcagtatccg
ttcgatatggtgataccgcttccaccaagcggaggtacgtccaaatga

DBGET integrated database retrieval system