KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011225Help
Entry
AaeL_AAEL011225   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
aag  Aedes aegypti (yellow fever mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 910 aa AA seqDB search
MQRSVRVNEHQLIMLSDRAQYDHSMHGHLHKRTADNNKWQMRWFVLYQNLLFYYESEQSS
RPSGLIFLEGCYCERLVSAPSTLSGPPIGSGGGQGSKVVKEEKLQHCFTICYRRENQRQY
ELRASTESECSAWIIAIREASFNKLLLQKEELEQKHVHLLQVVESEKTAKWQYTQQCEEL
ASEIRKLRTEVSSICFSLCSHHPIPTESHDEHSSLPGLCASVHDSIELRKIKKVQSFFRG
WLCRRRWKQIVEEYIRSPHAESMRKRNHLVFSMVEAEEEYLEQLEVLVACFLRPFKMAAS
SKRPPCSHEDVNSIFLNSETVLFLHQIFLKGLTSRLESWPTLVLGDLFDMLLPMLSIYQE
YVRNHHYSLQVLTECKSNPNFATVLKRLEAKPTCQGRSLETFLTYPMHQIPRYIITLHEL
LAHTPHDHVERKSLQNARQQLEDLSRQMHDEVSETENLRKNLAVERMIVEGCDILLDVNQ
VFVRQGSLVQVPPGRGRIRSRLASFKSERDAVRQCFLFSNHMIIATRTSGGRLHLLPDVG
KIPLADATLIEDPSEVQHEDEDASVCSASTRGSTLSVTESVNAGNRDFKIFVETKSGARH
SIHLIAPTIQDKEAWISDISQCLDNIHMHSLLSPGIGGSSGGHQALRADPRLFKDDVDIR
FSRTLNSCKLPQVRYATPERLLQRLTDLRFLSIDFLNTFLLTYRVFTDGETVLNALKSVF
YDPPVEPTCDCDHQTDFLELPYQDGRASPRRTSGASSVSEAAMSGPSSPSNLSSVTLVGS
TGSGGQDKSEAQTPTEGTFKYGKAPTGPLPERVYPKQRKDIPPTILPQTPPTVTTTPCHS
PSTVQQQQQQPQPMLITKDQQPTTGSEKLQPQISSPRLTARKFSAPKTPERQRKSLFGTP
QRERDSSRQE
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggtccgttcgtgtcaacgagcatcagctgattatgctgtccgatcgggcacag
tatgatcactcgatgcacggacacttacacaaacggacggcggacaacaataaatggcag
atgaggtggttcgttttgtatcagaacctgctgttctactacgaatcggagcaatcaagc
cgtccctcgggattgatctttctggaaggatgctactgcgaacgacttgtttcagccccc
tcaacactttccggtccgcccattggcagtggtggcggacagggctccaaagtcgtcaag
gaggaaaagttacagcactgcttcactatatgctacagacgagaaaatcaacgacagtac
gagctgcgggcctccactgaatcggaatgctcagcctggataattgcaattagggaagca
agcttcaacaaactactactgcaaaaggaagagctcgagcagaagcacgtccacctgctt
caggtcgttgaaagcgagaaaacagctaaatggcagtacactcagcaatgtgaagagctt
gcgtctgaaatacgaaaactaagaaccgaggtaagtagtatatgtttttccctctgctcg
catcatcccataccgaccgaaagccacgacgagcactcatcgctgccgggtctttgcgct
tccgtgcacgattccatcgagctgaggaagatcaaaaaagtgcaaagcttttttcgtggt
tggctctgtcgccgacgctggaagcaaatagtcgaagagtacatacggtcaccccacgcc
gaaagtatgcggaagcggaaccacttggtattcagcatggtcgaagcggaagaggaatac
ctggaacagctggaggttctcgtagcgtgcttccttcgtccgttcaaaatggccgccagc
tcgaagcgcccgccatgctcccatgaagacgtcaattccatcttcctcaactcggaaacg
gtcctgtttctgcatcagatcttcctgaagggcctcacatcgcgtctggagtcgtggcca
acgttggttcttggtgatctgttcgatatgctattgcccatgttgagcatctatcaggag
tatgtacgcaatcatcactacagtctacaggtgctgaccgagtgcaaaagcaatcccaac
tttgccaccgtcttgaaacgactggaagcaaagcccacctgccaggggcgcagtctggaa
acttttcttacatatccgatgcatcagattccgaggtacatcatcaccttgcacgagctg
ctagcccacacgccgcacgaccacgtggagcgtaagagcttgcagaatgcgcgccaacaa
ctggaggacctttcgcgccaaatgcacgacgaggtctcggaaacggaaaatctgcgaaag
aatctagccgtagagcgcatgatcgtcgaggggtgcgacatactgctcgatgtcaatcag
gtgtttgtgcgacagggaagtttggtacaagttccaccgggaaggggaaggattcggagt
cgtctggcttcgttcaaaagcgaacgggatgctgttcgacagtgctttctcttctcgaat
catatgattatagcaacgagaacatccggaggacgactgcacttgttaccggatgtgggt
aaaattccgctggcggatgctaccctcatcgaagaccccagcgaagtgcaacacgaggac
gaggatgcttcggtgtgttctgcctctaccaggggcagtaccctgagtgtaaccgaatcg
gtgaacgccggaaatcgggatttcaaaatctttgtggaaacaaaatccggagcaaggcac
agtatacaccttattgcgccgaccattcaagacaaggaagcctggatcagtgacatatcg
cagtgtttggacaatattcatatgcactcgttactgtcgccaggaatcggaggttcgtct
ggaggacatcaagcacttcgagccgatccaaggctgttcaaggacgacgtagacattcgg
ttttcacgaacgctcaactcatgtaaattacctcaggttcgttatgcgaccccggaacga
ctactgcaacggttgactgacctacggttcctatcgattgactttttgaacacgttcctg
ctcacctaccgtgtgttcaccgatggagaaacggtacttaatgcgttgaaaagtgtattc
tatgatccaccagtggaaccgacgtgtgactgtgaccatcagacggactttttggagctg
ccctaccaagatggacgtgcgtctccgcggagaacatccggagctagttctgtttctgaa
gctgcaatgagtggaccttcgtcaccgtccaatctaagcagtgtcacattggtgggatca
acggggtccggcggacaagacaaatcggaagcgcaaacacccacggagggcacgtttaaa
tatggcaaagctccgacaggtccactgccagaacgtgtttatccaaaacaacggaaagat
attcctccaacaattttacctcaaacgccgccaacagtaacaactacgccatgtcacagt
ccttccactgtccagcagcaacagcaacagccgcagccaatgctaatcaccaaagaccaa
caaccaacgacaggcagtgaaaagctacagccacaaatcagcagtccacgtttgaccgca
cggaagttctccgctccgaaaacgccggagcgccaacggaagagtctcttcggaacgcca
caacgggaacgcgactcgtcgagacaagagtaa

DBGET integrated database retrieval system