KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011287Help
Entry
AaeL_AAEL011287   CDS       T01053                                 

Definition
ubiquitin specific protease
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    AaeL_AAEL011287
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AaeL_AAEL011287
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AaeL_AAEL011287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 1037 aa AA seqDB search
MLTATFELEQEDVSPNNILEPQQQQKQLKEKSDLTTSVKQQQQQREESNRVTTNHGADSE
RRRTAENRKSLFLSPLGCGWGFNRQRQQQPEQRSPPVRQFPLIKLKRRYKDKENSVRSQK
EEPLESSSKSEREEVPTKKRSLLEQVEADIQRRLKASISEEKSRKRKFGCLSLVAIGQSE
SKKKKKQEVESVVQVEKPVVEEEPQEVISQGSSGSLSVKSRLSSSQQQIDWDQAEEISID
SSTEDGPEEPVKSVFDFDSLFEDTKVKPPPIRTYSGCSSSRLSLSKNFLQQQQQQQQQVL
NVPQTAIVAQEEASRTDKLAGGGGGEDDMSIHHQQRFNLLSLYNSVSSTSSSVNYQQDFV
PASSYLLLAEESQTMSAHPHYTRSKVNSMQSSRLTLNSATDMAITASMNELPRSKVSSLQ
GRVDTGTATELAIAQSLSEDQQNLLNSVAAPATPASIAAAANMNNSLATLCNIGNSCYLN
SVLYTLRFAPNFIHNLHHLIVDTDSVYQRLNQNKLKSSSLGRNIPGLHNPSGRSWSSKDL
ASLGSSTTTTNSSSSTGSGTTTVGVNGTGSGGGGVSGITLLSREENFPPKSNRQVVTEQL
HELFQNLHRNEDIETLEPFHAGNILRAVQDVSSTFEGNQQQDAHEFLMCVLDSIRESCQA
LIRTITDHPDVLISACPAVPECIETLEPQPKSSTPWSFRWRKDSVKTSKSTSNGGGGSSG
ATTLPKAAGSVGGTGGGGGDASDSLTSLFGKTSSVADERLVRDRLQALGLDFFRDDFEGV
TVAKTKCLACETCTEQKETMIDIAIPIASNEVSDAAKNPQLFYQNSCITREYFRGDNKYR
CEECCGYREAIRSISFEVLPRQLILQLKRFNGDMEKINSYIPTPFVLRCFCDTCLPKQDC
DKPHIYRLYSVITHVGARMSVGHYIAYTSSLDVHAEYLGCGKDRRKQLFLSGGSLDGLAG
SGVSGGSVGSIASAKSNSEKGLKKFFGGKKASSAGDMSKKSKTIAVNKMINGIESLNLIN
GSSTGSNNSASFGGSHS
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atgctaacagccacatttgagctcgagcaggaggatgtaagtccaaacaatattttggag
ccacagcagcagcagaagcagctaaaagaaaaatccgacctaacaacatcggttaagcag
cagcaacaacaacgagaggagagtaatcgagtaacgacaaaccacggcgccgattccgag
cgaagacggaccgccgagaatcggaagtcgctgttcttatcgcccctcggctgtggatgg
ggtttcaaccggcagcggcagcagcaaccggaacaacgttccccaccggttcgacaattt
ccattgattaaactaaaacggcgttacaaggacaaagaaaacagtgtcagaagtcagaag
gaggaaccgttggaaagcagtagcaaatcagaacgtgaagaggttccgacgaagaagaga
tccttgttggaacaagtagaggcagatatccagagacggttgaaggcgagtatcagcgag
gagaagtcacggaagcggaagtttggctgcctgagtttggtggctatcgggcaatccgaa
agcaagaaaaagaagaaacaagaggtggagagtgttgtgcaggtggagaaaccggtggtt
gaagaggaaccacaggaagtgatcagtcaaggttcgagcggaagtctttccgtgaaaagc
agactctcgtcgtcgcagcaacaaatcgactgggatcaggcggaggaaataagcattgac
tcttcaacggaggacggaccagaggaaccagtcaaatccgtcttcgatttcgactcattg
ttcgaagataccaaggttaaacctcctccgatcaggacctacagtggttgttccagttcg
agactttctctgtcgaagaactttcttcagcagcaacaacaacagcagcagcaagtgttg
aatgtgcctcaaacagcaatcgtagcacaggaggaagcgtcccgaacagacaaactcgcc
ggaggaggtggtggtgaggacgacatgtccattcaccatcaacagcgctttaatctactg
tcgttgtacaacagtgtgagcagcactagtagtagcgtcaactatcagcaggattttgtg
ccggcctcctcgtacctactgctggcggaggagtcccaaacaatgtccgctcatccccac
tacacccgtagtaaggtcaactcaatgcagagcagtcgcctgacgctgaactctgccacc
gatatggccattacggcgtcaatgaatgaactccctagaagtaaggtaagcagtttgcaa
ggccgggtggacacgggaaccgcaacggaactggctatcgcccaatcgttgagcgaagac
caacagaacctgctgaactcggttgccgcgccggcaactccggccagtatagccgctgct
gccaacatgaacaactcgttggccaccttgtgcaacattggtaactcgtgttacctcaac
tcggtgctgtacacgttacgctttgcgccgaactttatccacaatctgcaccatttgatt
gtagacacggacagtgtctaccagaggctaaaccaaaacaagctgaaatcctcatccctc
ggacggaacattcccgggctgcacaaccctagtggacgcagttggagcagtaaggatctg
gcatcgctcggaagctccacaaccaccaccaactcctcatcgtcaaccggttccggaacg
accacggtcggggtcaatggaaccggcagtggcggtggtggcgtcagtggcatcacgctg
ctctcccgggaggaaaactttccgccgaaaagcaatcgccaggtggtgaccgagcagcta
catgaactgtttcagaacctgcaccggaatgaggacatcgaaacgctggaaccgtttcac
gcggggaacatcctgagggccgtgcaggacgtcagctcgacgttcgagggcaaccagcag
caggatgcgcacgagtttctgatgtgtgtgctggacagcatacgggagtcgtgccaggcg
ctgattaggaccatcaccgatcatccggatgtgctgattagtgcgtgccccgcagtgccg
gagtgtatagaaacgttagaaccgcagccgaaaagcagtacaccgtggtccttccgctgg
cggaaggattcggtgaaaacgtccaagtcgacgagcaacggaggcggtggaagcagtgga
gctaccacactgccaaaggccgcaggatctgtcggtggcaccggtggtggtggtggagat
gcgtccgactcgttgacctccctctttggcaagacgtcttccgtggcggacgaacgcttg
gtgcgggaccggctgcaggcgctcgggttggatttcttccgggatgatttcgagggcgtc
accgtggccaagaccaagtgtttggcgtgcgaaacgtgcaccgagcagaaggagaccatg
atcgacatcgcgattccgatcgcgtccaacgaggtgtccgatgcggccaaaaatccacaa
ctgttctaccagaactcctgcatcacgcgagagtacttccgcggggacaacaagtaccgg
tgcgaggaatgctgcggctaccgggaagccatccggtcgatttcgttcgaggtgctcccc
cggcagctaattctccagctgaagcgcttcaacggggacatggagaagatcaacagctac
attccgacgccgttcgtgctgcggtgcttctgtgatacgtgtttgccaaagcaggactgt
gataagccgcacatctaccggttgtacagtgtgataacgcatgtgggcgcgcggatgtcc
gttggccactacattgcctacaccagttcgctcgatgtgcacgccgagtatctcggttgt
gggaaggaccggcggaagcagctgttcctgtccgggggctcgctggatgggctggccggg
agcggtgtcagcggaggcagcgttggaagcatcgcttcggcaaaaagcaacagcgagaag
gggctgaagaagttcttcggcgggaagaaggcctccagtgcgggtgatatgagcaagaag
agcaaaacgattgcagtcaacaaaatgatcaacgggatagagagtctcaatctaatcaac
ggttccagtacgggaagcaacaattcggcctcattcggtggttcgcactcgtga

DBGET integrated database retrieval system