KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011473Help
Entry
AaeL_AAEL011473   CDS       T01053                                 

Definition
chromatin regulatory protein sir2
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     AaeL_AAEL011473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 391 aa AA seqDB search
MIVVFRVQVFEKSANLSDCTNKAMSCNYADGLSDYQNKGILGVPEIFDDAETVEEKCEQL
AKWILGSKHVVIHTGAGISTSAGIPDFRGPKGVWTLEKKGEKPSVNVAFDEAKPTKTHMG
LKALVEAGFVKYVISQNIDGLHLRSGLGRKYLAELHGNMFIEQCLKCRRQYVRSKPAPTV
GKKLTGELCRGTKNSRACRGGNLIDNILDWEHDLPESDLDLAFMHSTLADLNVCLGTTLQ
IVPSGNLPLRNKRYGGKLVICNLQPTKHDKKADLKISTYVDTIIEKVAKRLGVEIPAYTK
EVDPTKAEPCSLEWTIPTEEVKSLDKHYSKTVREWSKNRKKGGCREEEADEFEFKSKKFK
KEKAESNDQDATTVVETEAEVKSEQTDVEVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgtgtttcgtgttcaagtttttgaaaaatcagcgaatttaagtgactgtacc
aacaaagctatgtcgtgtaattatgccgatggtttatcagattaccagaacaagggcata
ttgggagttccagagatttttgacgacgcggaaacagtggaggaaaagtgcgaacagctg
gcaaagtggattctgggttcgaaacatgttgtgattcacaccggagccgggatcagcacc
agtgctgggataccggactttcgcgggcccaaaggcgtgtggacgctggagaagaaaggc
gaaaagccttcggtgaatgtggcttttgatgaggccaagccaaccaaaactcacatggga
ttgaaggctctggtcgaggccggattcgtgaaatacgttatcagccagaatatcgacggg
ttgcatttgcggtctgggttgggtcgtaaatacctggcggaattgcatgggaacatgttc
atagagcagtgcctcaaatgcaggcggcaatatgtgagaagcaaaccggcgcccaccgtt
ggaaagaaattgaccggagagctgtgtcgggggacgaaaaactcccgggcttgtcggggc
ggcaatctcatcgataacattctggattgggagcacgatctgccggagagcgatttggac
ttagccttcatgcattccacgctggcggatttgaacgtttgcctcgggacgacgctgcag
attgttcccagtgggaatttaccgctaaggaacaaacgctatggtggcaagctggtcata
tgcaatttgcaaccgacgaagcatgacaagaaagccgatctgaagatatcgacctacgtg
gataccatcatcgaaaaggtagccaaacgattaggcgtggaaatcccagcctacacgaag
gaagtggaccccaccaaagcggagccgtgttcgctggagtggaccattcctaccgaagag
gtgaaaagtttagataaacactattcaaaaaccgttcgcgaatggtccaagaacagaaag
aaaggcggctgccgggaggaagaagctgacgagttcgagttcaaaagcaaaaagttcaag
aaggaaaaggcggagtctaacgaccaggatgctactacggtggtcgaaaccgaagcggaa
gttaaaagtgaacagaccgacgttgaagttgagtaa

DBGET integrated database retrieval system