KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011517Help
Entry
AaeL_AAEL011517   CDS       T01053                                 

Definition
(RefSeq) AAEL011517-PA
  KO
K20730  
beta-hexosaminidase Fdl [EC:3.2.1.52]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AaeL_AAEL011517
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AaeL_AAEL011517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 548 aa AA seqDB search
MAFTGSLRKTLFGLLLVMIFLVMLLYWNENQSPIKPAGSAMLFARIFHREGVVGGSEGTW
TYKCVNNRCSAFGGSTTGKRVPFLTCTMTCGPINIWPQPTGKASIGSKASRFRLSDVHFN
VKTAHKPVEDLLWDAFRVFKEELRAVLVARGAGADEADSSTVTENGDAARGKGQQDVGAK
VEGSAAKISRYDVDRFDVRINVLKSPEIHLTMQTDEGYNMTVGHTARSLVVKVFANSFFG
AKHALTTLQQLIWFDDEERILKVLNKALIEDVPRFNFRGLMLDTSRHYFSVESIKRTLVG
MSHSKLNRFHWHITDSQSFPLVSKHYPQLAQYGAYSDREIYTADDIRDIVQFARERGIQV
IPEIDAPAHAGNGWDWGPKHNLGDLSLCINQQPWSYYCGEPPCGQLNPKNNNTYLILQKL
YEELLDLTGPLDYFHLGGDEVNLECWQQHFNESDMRTLWCDFMQQAYHRLQIANKGVAPK
MVAVWSSGLTNYPCLSKNSFAVQVWGGSKWQENFQLISAGFNLVISHVDAWYLDCGFGSW
RSTGECSC
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcattcaccgggtcgctcaggaaaaccctcttcggactcctgctggtgatgatattc
ctggtgatgctgctctactggaacgagaaccagagccccataaaaccggccgggtcggcg
atgctgtttgccagaattttccaccgggaaggagtcgtcggcggtagcgaaggaacctgg
acgtacaagtgcgtcaataaccggtgcagcgcgttcgggggcagcactacggggaaacga
gtcccgttcctgacctgcacgatgacctgcgggccgatcaacatttggccacagccgacg
gggaaggcttcaattggcagtaaggcttcccgcttccgcctgtccgatgtgcacttcaat
gtgaaaaccgcccacaaacctgtggaggatctgctgtgggacgcctttcgggtgttcaaa
gaagagctccgagcggttttggtggcacggggtgctggagcagatgaggcagatagttcg
accgttaccgagaacggagacgcagctcgggggaagggtcagcaggacgttggtgctaaa
gtggaaggatctgcggctaaaattagtcggtacgatgtggatcggttcgatgtgcgaata
aacgtacttaaatcaccggaaattcacctcaccatgcaaactgatgagggctacaacatg
acggttggacatacggcacgctcgctggtggtgaaagtttttgccaacagctttttcgga
gcgaaacacgccctcaccacgctgcaacagttgatttggttcgacgacgaggaacgcata
ctgaaagtattgaacaaagccttaattgaagatgtgccaagatttaattttcgtggcctt
atgttagacacatcgagacactatttctcggtagaatcgataaaacggacactggtaggg
atgtcccactcgaagctgaaccgatttcattggcacattacggattcgcaaagttttccg
ttggtgtccaagcattatcctcagttagcccagtacggagcgtattcggatcgggagatt
tacaccgcggacgacattcgtgatattgtgcagtttgcgagggagcgaggaatccaggtg
attccggaaattgacgcaccggcacacgccgggaacggttgggattgggggccaaagcat
aatctcggagacttgagcctttgtatcaatcaacaaccgtggagttattactgcggagag
cctccgtgtggccaacttaatccaaaaaacaacaacacttacctgatccttcagaagcta
tacgaggaactgttggacctgaccggccccttggattacttccacctgggaggcgacgaa
gtcaacctggaatgttggcagcagcatttcaacgagtcggacatgcgaacgttgtggtgt
gatttcatgcaacaggcgtaccaccggttgcagattgccaacaagggggtggcgccgaaa
atggtggccgtgtggtccagtgggctgacaaactatccgtgcctttcgaagaattccttc
gccgtacaggtgtggggcggcagcaagtggcaggagaacttccaactgatcagcgccggg
ttcaatttggtcatttcgcacgtggacgcgtggtacctggattgtgggttcggcagttgg
cgatcgacaggtgagtgttcgtgt

DBGET integrated database retrieval system