KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011686Help
Entry
AaeL_AAEL011686   CDS       T01053                                 

Definition
starch branching enzyme ii
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AaeL_AAEL011686
Enzymes [BR:aag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AaeL_AAEL011686
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AaeL_AAEL011686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 684 aa AA seqDB search
MATDQANPGIEKLLEQDGYLKLHEREIRRRNTELRNWINKLNQLEGGLDEFTQGYKYYGL
HIAPDNSLVAREWAPGAQQLYLTGDFNNWQWEATPYKKLPYGKWELTLPANPDGSCPIKH
LSEIKVIVRKQDGQLVDRLSPWAKYVVPPPKSLGVNYQQRVWHPPANERYTFRHKKPARP
RALRIYECHVGIATEELGVGTYKNFADNIVPRIKSLGYNTIQVMAIMEHAYYASFGYQVT
SFFAASSRCGTPDELKYMVDKAHEAGLFVLLDVVHSHASKNTQDGLNQFDGTNACYFHDG
SRGEHSLWDSRLFNYSEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFS
GDYNEYFGLNVDTEALIYLAIANYFLHKLDPNVITIAEDVSGMPTLCRPTDECGVGFDYR
LGMAIPDKWIQLLKTKKDEDWNIGNLVHTLINRRWMENTVAYAESHDQALVGDKTIAFWL
MDKEMYTHMSVMSEPNLIIDRGLALHKMIRLITHGLGGEAYLNFMGNEFGHPEWLDFPRI
GNNESFHYARRQWHLVDDQTLKYRFLNEFDRAMHHTEEKYHWLNCLPAYVSWKHEDDKVI
AFERNNLLFIFNFHNSKSFTDYRIGVELAGKYKVILSTDDKEFGGFDRIDKNVEHHTFPE
GWAGRRNYMQLYIPCRVAIVLAPQ
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgatcaagctaatcccggtatcgagaagctcctggagcaggatgggtatctg
aagctgcacgaacgtgaaatcagacgaagaaacaccgagctgcgtaactggattaataag
ctgaatcagctcgagggaggactcgatgagttcacacagggatacaaatactacggattg
cacattgctcccgacaacagtttggtggcacgtgagtgggcacccggtgcacaacaactg
tacctaaccggagatttcaacaactggcaatgggaagcaaccccgtacaagaagctcccc
tacggcaaatgggaactgactctgccggccaacccggacggctcgtgtccgatcaagcat
ctttcggagataaaggtgatcgtgcgcaagcaggacggccagctggtggatcgattgtca
ccgtgggccaagtatgtggttccgccgccgaagtcgttgggcgtcaactatcagcagcgc
gtgtggcatccaccagccaacgagcgatacacgttccgtcacaagaagccggcccggccc
agggctttgcgcatctacgagtgccacgtgggaatcgccaccgaggagctcggcgttgga
acgtacaagaacttcgcggataacattgtaccgaggattaaaagcctcggttataatacc
attcaggtgatggccatcatggagcacgcctattatgccagctttggctatcaggtgacg
agcttttttgcggcgtccagccggtgtggaacaccggatgagctgaagtatatggtcgac
aaagcgcatgaggccggattgttcgtgctgttggacgtggttcactcgcacgccagtaag
aacacgcaggatggattgaaccagttcgatggcaccaatgcttgctacttccacgatggt
tcacgtggagagcactcgctgtgggacagccgtctcttcaattactctgaatacgaagtg
ctccgtttcctgctgtccaacctgcgctggtggcacgacgagtacaacttcgatgggtac
cgcttcgacggggtcacttccatgctgtaccattcgcggggcatcggcgaaggcttctcc
ggcgattacaatgaatacttcggactgaacgtcgatacggaagcgctgatctatttggct
atcgccaactatttcctgcacaagttggatccgaacgtgatcaccattgcggaggacgtg
agcggtatgccgacgctttgccgcccaacggacgaatgtggcgtcgggttcgattatcgc
ctggggatggccattccggacaagtggatccaacttctcaagacgaagaaggacgaagat
tggaacattgggaacctggtgcacacgctgatcaatcgtcgctggatggagaacacggtt
gcgtacgccgagtcacatgatcaggccctggtgggagataagactatcgcgttctggttg
atggataaggagatgtacacgcacatgtcggtgatgtccgagccgaacttgatcatcgat
cgtggtctggcgctgcacaagatgattcgtttgatcacgcatggcttgggcggagaagcc
tatctgaacttcatgggcaacgagtttgggcatccggaatggttggacttccccagaatt
ggaaacaacgaatcgttccactatgctcgacgccagtggcatctggtggatgatcaaaca
ttgaagtaccggttcctgaacgagttcgatcgagcgatgcaccacacggaggagaagtac
cactggttgaattgccttccggcgtacgtgagctggaagcacgaggacgataaggtgatc
gccttcgagcggaacaatctgctgttcatattcaacttccacaatagcaagagcttcacc
gattatcgtatcggggtcgagcttgccggaaagtacaaagtgattctcagcaccgacgat
aaggagtttggcgggttcgatcggatcgataagaacgttgaacatcacacattcccggag
ggctgggctggccggcggaactacatgcagctgtatatcccgtgccgggtggcgatagtg
ctggctcctcaataa

DBGET integrated database retrieval system