KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011697Help
Entry
AaeL_AAEL011697   CDS       T01053                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AaeL_AAEL011697
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AaeL_AAEL011697
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AaeL_AAEL011697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 595 aa AA seqDB search
MNGPSRSKFGPLIGVLSVGHSNCKFLIYAARNAEVLTCHDEPLEVISPHSGWVEFDPGRI
WAKIRCCIERAVQNLELLEIDLRDMVAVGVCNQRETSVLWDRIGGEPLCNAIGWCDTRTS
GLVGGLLTRVKGKINFLKAVCGLPLANCFSAGKVRWMLDNVSGEVEGKEVLFGTLDSWAV
WNLTGGTNGGIHVTDVTNASRTMLMNLADLQWDDRLCHFFRIPKDILPQIRSCSEIYGYI
SEGPLRGIPIASCMGDQQAALVGQMCLSAGQLTCNVDEGSFLLFNTAQEIIDSDNGLLST
VAFKLGPKAKTFYALEGAIPHAGSTLSWLHDNLQLQSDSNHNGSLTQSFLGDPGGPSALL
SSVCSMSSSFGALQSEANKFKNPNYEVILVPAFSGYYTPYWRYKARGMLFGLTLQTTAQQ
ILFSAYEAICFQVREVLEALTKDCRTWPAITKLVAGGDLSEKPFLMQILADLCGVSIERP
QTSTPACLGTMLAAGLAMEILTLDEFRACCIPPTDQYSPALNSSHRDMKFRKWKIAVDRC
LNFDSVSETDLSKFQQEELDPEYSVRCSIPGGIYIISSFALIVLAQILQQSRSAS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaccgtcccgcagcaagttcggcccgctgatcggagtcctaagcgtgggccat
tccaactgtaaattcctgatttatgcggcgcgaaacgccgaagtgctgacctgccatgat
gaaccactggaggtcatttccccgcactcgggctgggtggaattcgacccgggccggatc
tgggccaaaatccggtgctgcatcgagcgggcggtgcagaatctggaactgctagaaatc
gatctgcgggacatggtggccgttggggtgtgcaatcagcgcgaaaccagtgtcctgtgg
gatcgaattggaggggagccgttatgtaatgccatcggatggtgcgatacgaggacttcc
ggtttagtgggtgggttgctgaccagggtcaaggggaagattaacttcctaaaggcggtt
tgtgggttgcccttggcgaactgtttcagcgccgggaaggtccgctggatgctggacaat
gtctcaggggaggttgagggcaaggaagtgttgttcgggacgctggacagttgggccgtt
tggaatctgaccggtggaaccaacggaggtattcacgtgacggatgtgaccaatgcctcg
aggacgatgctgatgaatctagcggacctgcagtgggatgaccggttgtgccatttcttc
aggattccgaaggacattttgccgcagattcggagctgctcggagatttacgggtacatc
agcgagggaccattgaggggcattcctatagcaagctgcatgggcgaccagcaagcggca
ttggtcggtcaaatgtgtctcagcgcaggccagcttacctgtaacgtcgacgaaggatcg
tttctcctctttaacacggctcaggaaataatcgactcggacaacgggctcctatcgacg
gtggccttcaaattgggtccgaaggcgaaaacgttttacgctttggaaggtgccattccc
catgcgggaagtactctaagttggttgcacgacaatctccagttacaaagcgattccaat
cacaacgggtcgttgacccagagcttcctgggagatccgggagggccctcggctctgctg
tcttcggtctgctcgatgagttcatcgtttggggctctccagagcgaggccaacaagttc
aaaaacccaaactacgaagtaattctcgttccggccttcagcggttactacacgccttac
tggcggtacaaagcccggggaatgctgttcggcctgacgctccaaactacggcccagcag
atcctgttctccgcctacgaggccatctgcttccaggtgcgcgaagttctggaagcactc
accaaagactgccgaacttggccggccattacgaagctggtggccggtggggatctcagc
gagaagccattcctgatgcagatcctggccgacctgtgcggggtgagcatcgagcggcca
caaacctccacgccggcctgcctcggaaccatgctggccgccggtttggccatggagatt
ctcaccctggacgagttccgtgcgtgttgcattccgccgaccgatcagtactcgccggcc
ctcaattctagtcatcgagatatgaagttccgtaagtggaaaatcgcagtggatcgctgt
ctgaacttcgactccgtttcggagacggacctttccaaattccagcaggaggaactggat
ccggaatactcggtccgttgttcgattcccggagggatctacataatttcctccttcgcc
ctgatcgtactggcgcagattctccaacagagtcgatcggcctcctag

DBGET integrated database retrieval system