KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011837Help
Entry
AaeL_AAEL011837   CDS       T01053                                 

Definition
(RefSeq) AAEL011837-PA
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AaeL_AAEL011837
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   AaeL_AAEL011837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 328 aa AA seqDB search
MRHGLSIMLETFTDRSFVFLAFLITGTGTFGRVCLCRDKETDKYWAMKILAMADVIRLKQ
IEHVKNEKNILREIDHPFVVNMRWHAKDDCCLYMLFEYVSGGELFSYLRNAGRFDNATAN
FYACEIVLALEYLHALSIVYRDLKPENLLLDRDGHLKITDFGFAKKLKDRTWTLCGTPEY
LAPEIIQSKGHNKAVDWWALGVLIYEMVVGYPPFYDDNPFGIYEKILSGKIEWSRHIEPI
AKDLVKKLLVQDRTKRLGNMKNGAEDIKRHRWFKHLDWDVVIRKQLKPPIVPKFVFEGDT
SNFDDYPETDWKSARSLDKVEMQLFEDF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagacatggcttatcgatcatgctagaaacatttactgacaggagtttcgtttttctc
gcttttttaattacaggtaccggcacgtttggcagggtatgtctctgtcgagacaaggag
acagacaagtactgggcgatgaagatcctggcgatggccgacgtgatacggttgaagcag
atcgagcatgtcaaaaacgagaagaacatcctgcgcgaaattgaccacccgttcgtcgtg
aacatgcgatggcacgccaaagacgactgctgcctctacatgctgttcgagtacgtcagc
ggcggtgaactgttctcctatctgcggaacgccggccggttcgacaacgccaccgccaat
ttctacgcctgcgaaattgtgctcgccctggagtacctgcacgccctgtccatcgtgtat
cgggacctgaaaccggagaatctgctgctggatcgggacggacatctaaaaatcaccgac
tttggtttcgccaaaaagctgaaagaccgaacctggacgctgtgcgggacgcccgagtac
ctggcgccggaaatcatccaatccaaagggcacaataaagccgtcgactggtgggcgtta
ggagttcttatctatgaaatggtcgttggatatccacccttctacgacgataatccgttc
ggtatttacgagaagatcctcagcgggaagatagagtggtcacggcacatcgaacccatt
gcgaaggatctggtcaagaagctgctggtacaggaccgaaccaagcgattggggaacatg
aagaatggagccgaggatatcaagaggcatcgatggttcaagcacctggattgggatgtc
gtgatacggaaacagttgaagcctcctatcgtgccaaagtttgtattcgagggagatacc
agcaatttcgacgactacccggaaacggactggaaatcggcccggtcactggacaaggtt
gaaatgcaactattcgaggatttctaa

DBGET integrated database retrieval system