KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL011975Help
Entry
AaeL_AAEL011975   CDS       T01053                                 

Definition
ubiquitin specific protease
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 3561 aa AA seqDB search
MCDVCSGFLNLLGSYESRLANNETEHPVFLAKREIETVIGYIQCWPARQCMCCYRDPKNF
ERFNLVVQAIVYFTVYQLKNIKSLLDREEQRIAAVAAQQPASSSSSSSTSSSSSASSSSS
NNGKDDEKESEEDAKRKEEDVARNSEAVEKPEQEEEPKERKLQPDSVPTLDDCWTLLDVE
KLLLLSSKAFLLNFPLYVAYKHGVHARMDEISPQEAQTLSIFCDLHDNEIPAFLLRNVSL
FCTSGGFDAMMACFEHANLPVPIAHAITAAISNLKLWINYRSIIQLFIPIRVKILQYMCK
LSDQDLRSPATKSMADFMWTAIKDPLDSQITFDTEGLALAFKYFTSSTLTMRLAGMAQIN
AHINLFNEICTTETVAEVEVVGQKLADWLTENQIISHLFGPNLHVEVIKQSHIVLNFLAV
ENQITEEHITLIWQAAQLKHCSKPIYDILPSLVKNLAPRPASHLYSLLSRLDPKEHTEQS
IYIASALTKLIWARDCSRLTLMDLAKNNVLREAAANSVSVDGSNSEDEPQEEDTAAVVSG
GKNSVAASDSGVAAPPPCKQARHKNCCDETTDGGFWDWRIPLMSRSLAAASGFTEDAGTS
SEEDCLGMSEAFSAMRKKMLRKKRKKISGLTRKELQEMAESVSDVEDSDLLAAMLPDSDC
SDTNLQSSVLRHMGGHHGPIGPVGPEPGEDVPPFMGAMSEGHLINFLNAAENDGSCSSPL
SNKSEKNMGDFDDEDSPCEEELVELAARAQCLHQQFPLPRPRSLGPGMVHGSPQARTNTP
NITLTRAHHDRLSSSGGSIGPMTHPMTPSVSSSGTPTSTGGKGGKMNPATPTTMGGKTPQ
APSKEMQAASASGSTGGSSSSLGAPSSPNIRFPDVCQPGNTLLWDLLQDDKIGQLGESLA
LEAEKVLGTLLCFHTDKIIRTRFIEGCLQNLAENRSVVTSLRLLPKLFASFQQFRDVTTH
QVVLWAERHHRMMHHFFNNLKHYTTGAGRSGRQSETSTIVLNQNGFPLYSHVTQIQVRLQ
FLSSVFSDVGSPRNFKLTLSQVDTLWACLANDPECSDCLFAWLQGQVKGGDTHALGINAI
QHLYLKRLSELKPEGISMVALGLFQQLFTLGREEIISHPSESQESSDSVGMEHLWKIALR
AHNTDVSLTAIQYINTYYMEKQLKYENQFVAQCMTHLTQAVEELDRQGPGSENALMCVQR
ALMLLNTHLETFRRRYAYHLRRWALEGKEVGMHSALRNEGPGPPIRIVLQPAGVPEKSVL
HLHATDLVADLKAEIAKWWETIQGSVKTAHNETVLGLLLSEGPLRIITQGQEITAEYDER
SLADVGFKDNQMVYVSMGSRGGRRRDHHDHPSMQPPPPKDCLPTLLLLKSPYFEQLFKLM
QTLGDMKLIGPGGRIQPNTKAQLLSRRVWDILAMLPTAPTFLSTLKNLSFKDPDSEPSID
MDSPDNPTYTLQEILEPRNLQKFMYSLHIVESLCKSKFMGSCCGGSPAGAPSQLKLKISS
SKSLKLQNQKLAKQQAQVLGVSNSNVGGMVSPSKLSVSPSGGERKMDVCDGGEGKTGEVE
NKENNGAEGASSPEKKDEEKEGIPQLSPPMAHPTPPPPKLPTSPASASLEWSEQFIKCGG
LAHLYQIFISGVLQKQSVAKDGDDLNEWRHDCLASLLRILCLLGMEEFKPENENAIIIPK
LNRHTLALMEVRPTLERIAGILNEESHPLSPHHFKTGLFGRAQVIHYAMNLLVCYAHSLA
EVRSTLWKVDANLAWVQRLILDDPEPAVRREACAALYRMCLGNAQTYYELMAPLLSKLVA
LLPLAEKMRPQSQAYHLSPDEGKEPYGPACRDYFWLLCRLVDSLSPELVKDCGSIGIESM
CRQVSKSILDRDYLESRHGSPDDGLFGLLNLMANLVKFDPQFKFSDDGQDFIGKIFQSLF
ELPSPDDREKPKCKSHGARAAAYDLLVEMCKSAPKNYLLLHGKLMQQHRAGPHSPYPWDY
WPRDEGRSECGYVGLTNLGATCYMASCIQHLFMTPQTRDAILSISPDAPQKHKATLYELQ
RMFAYLMESERKAYCPRSFCRVYQMDHQPLNTGEQKDMAEFFIDLVSKLEEMTPELKTLV
KRVFCGVISNNVVSLDCGHVSRTLEEFYTVRCQVADMRNLHESLDEVTVKDTLEGDNMYT
CSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTMLKEKVNTHFSFPMRLDMSGYVEK
TLMPQHYQEEKRKSELRRSASRNAAEKAEIQKQQQTLDEEDSEDFNEHYEYDLVGVTVHT
GNADGGHYYSFIKERNEDSNPNHQERWFLFNDAEVKLFDPSQIAAECFGGEMTSKTYDSV
TEKYLDFSFEKTNSAYMLFYEWRSNKGSNIQRDQVSKPSTCTSGASMTSISEQPVTSSSS
SAFASSGPCTTASIGASISENDSPSELPLPSPPSIAAVLPPVNIRDAADQTERIILKHPG
EAPSVVDNLNTLSKCDIDVKPSLRSTVGVVPSLASVPGQPTISSALQPCTSSAAAPSGLS
LVGLGKELEEWIWQDNRHFLQDRNIFEHTYFNFMWQICGHIPQTLLALPDITCIAAQLSV
SFFIETFIHAKEKPTMVLWVELLTKQFNASQEACEWFLSHMSAEPWWPVQVLIQCPNQMV
RQMFQRLVIHVIQRLRQSHSALYLKVESDEDGNEIIGNVSCVTRFIKSLIMLMEHGARAH
LRHLSEFFGLLYEFSRMGEEEALFLLRINVIRSVADFYLGHKAQDCIDTNSDNEDNSSDE
ALTVDKSRPASLDKMIALVASLVERSRGPDLRLHLSARDYNAIAGGKGFPFLYQQIKDNI
NPHQTRHLIHALCRCDERLAGQIIAMLFTAVTKHTELCGPFFKLLTLLTESTGGPSGLPC
FSQLVLQRVWDAAEYCPQSALDWLAVQAPRNKIAHTWILQSAESWVETFLLAHNNARVRN
AAAYLLVSLVPSQNFRTNFRATSHHKLTMHASQPREISCEAQLILHTILNLLLRLLRSAR
NYTDISVHGTTKLTAYFNLMTYCLVSKTEKLMLGPHLRALWELFHPRLSEPSVPAHHNKQ
ALLAFWYQATLDCPENALLVANCPDITRNIAFNYILADHDDSEIVTYNRAMLPVYYGLLR
MCCQQSRLLTRQLAAHQNLQWAFKNITPHPTQYPLAVDELFRLMTLFAQRHPDATEAEQR
EVTIFRRTTLTAYLSGLDARVSWGTLIAALRILVDNDDDRLFVVLNGGITLCFDALHTLH
SMYHEATACHVFGDLQELLTEVILLISTLRASCREQKKRPPPALMKGLPDAVRRLATLLN
TFNPPEMRNLALEVLKELVKCAPPEIISTVLVPLLTHCHTQNVAHTMGPLGSYFPRRGMK
AQWPPVSKNTPRPPRPMVQMNIPQSQICEKGLDKDFDLALELFYRPYHEFLDIMFRVAVT
SSQFNEPLVHLSLLTGIEAVVLHFNIFAKFWVGIYNNKTTNRYAELLIKNPLLVDYIDEI
LRDERLSLNDPVIANFIEIYYPKVKSRLVVPRLLESICQLLPDKGNLEDICGDLQAIRII
GQRTGIPGSVKTLLQNSLHAV
NT seq 10683 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgatgtctgctcggggttcctgaatctgctggggtcatacgaatctcgtctcgcc
aacaatgaaacggaacatccagtgtttctcgccaagcgcgagatcgaaacggtcatcggc
tacatccagtgctggccggcgcggcagtgcatgtgctgctaccgggatcctaagaacttc
gagcgcttcaacctggtagtgcaggccatcgtctacttcacggtgtaccagctgaagaac
atcaaatcgctgctcgaccgggaggaacagaggatagcggcagtcgcagcccaacagcct
gcctcttcatcgtcatcatcttcgacttcttcctcatcgtcggcatcctcgtcgtcttcc
aacaacggaaaggacgatgagaaagaatcggaagaggacgccaaacgaaaggaggaagat
gtcgctcgtaacagcgaggcggtggaaaagccggaacaggaggaagaaccgaaggagagg
aagctgcagccagattctgtgcccacgttagacgactgctggacgctactagatgtagag
aagcttcttttgctatcgtcgaaggcgtttctgctgaacttcccgctgtatgtcgcctac
aagcacggagttcacgccagaatggatgaaatctccccgcaggaagcgcaaaccttgagc
atcttctgcgatctgcacgataacgaaattcctgcatttctactcaggaatgtttctctt
ttctgtacttccggtgggttcgacgccatgatggcctgtttcgaacacgcgaatctaccg
gttccgatagcccacgctatcacggctgccatttccaatctaaaactttggatcaactat
cgatccatcatccagctgttcatcccgataagagtcaaaattctacagtacatgtgtaag
ctgtcggaccaggatctgcgctcgccggccaccaaatcgatggcggatttcatgtggacc
gctatcaaagacccgctagattcacagatcaccttcgacacggaaggcctcgccttggca
ttcaaatacttcaccagttcgacgttgaccatgcgattggccgggatggcccaaatcaac
gcccacatcaatctgtttaacgaaatttgcacaacggaaaccgtggccgaggtggaagtc
gtcggtcaaaagctggccgattggctcaccgaaaatcaaatcatttcccacctgtttgga
ccgaatctgcacgtggaggtcataaagcagagccacattgtgctgaacttcctggccgtt
gaaaatcaaatcaccgaagaacatataacacttatatggcaagcagctcagctgaagcat
tgctcaaaaccaatctacgacatccttccttcgctggtgaagaatctggctcctcgaccg
gcttcccatctgtactcgttactatcccgcctggatcccaaagagcacaccgagcagtct
atctacattgcgtccgctttgacgaagctcatctgggctcgagactgctcccggttaacc
ctcatggatctggcgaagaataatgtactgcgggaagcagcggcaaactccgtctccgtg
gatgggagcaacagcgaggatgaaccccaggaggaggacactgctgccgttgtttccggc
gggaagaattcggtggctgcctcagactcgggagtggccgcgccgccaccctgcaaacaa
gcccggcataaaaactgctgtgatgagacgactgacggtgggttttgggattggcgcatt
cccctgatgagccgctcgttggcggccgcttccgggttcaccgaggatgccggcaccagt
agcgaagaggactgcctcggtatgagtgaggcgttttcagccatgcgtaagaagatgctc
cgcaagaagcgcaagaagatcagcggcctaacccggaaggaactgcaggaaatggccgaa
agcgtttcggacgtggaagatagtgatctgctggcggccatgcttccggatagcgattgc
agcgatacgaatttgcagagttcggtgctgaggcacatgggcggccatcatggtccgatt
ggtcctgttgggccggaacctggcgaagacgttccgccgtttatgggcgcaatgagcgaa
ggccatctgataaacttcttgaatgccgctgagaatgatggaagttgttcttcgccattg
agcaacaaatccgaaaagaacatgggagactttgacgacgaggattcgccgtgtgaggag
gaactggttgaattggcagctcgagcgcaatgtctgcatcaacagttccctctaccgcgg
ccacgttccttagggcccggaatggttcacggatctccgcaagctcgaaccaatactccg
aacattactttgacgcgggcacatcacgaccggctgtccagttccggcggaagtatcggc
ccaatgacgcaccccatgacgccgagtgtgtccagcagtggcactcctacgtccaccggt
ggcaaaggtgggaagatgaatccggcgacaccgacgacaatggggggcaagactccgcaa
gcgccctccaaggaaatgcaggctgccagtgccagcggaagcaccggtggtagcagcagc
agtttgggggcaccgtcgtcgccgaacatccgattcccggatgtctgccagccgggaaat
acgctgctgtgggatctgctgcaggatgataagattggtcaattgggagaatcgctcgca
cttgaagcggagaaagttcttggaacactgctctgctttcacacggacaaaatcatccgg
acgcgtttcatcgagggctgtctgcagaatctggcggagaaccgcagcgtcgttacaagt
ttgcggttacttccgaagctattcgcatcattccagcagttccgcgacgtcacgacgcat
caggtcgtactgtgggccgagcgtcatcaccggatgatgcatcacttcttcaacaatctc
aaacattacaccacaggagcggggcgcagtggtcgacagtccgagacttcgacgatagtg
ttgaaccagaatgggtttccactgtactcgcacgtgacccaaatccaggtccgattgcag
ttcctgtcgtccgttttcagcgacgttgggtccccgcggaacttcaaattgacgctcagc
caggtcgatacgctgtgggcctgtctggccaatgatcccgagtgcagcgattgtctgttt
gcgtggttacagggtcaggtgaaaggtggagacacgcacgcccttggaatcaatgccatc
cagcatttgtacttgaagaggctgtcggagttgaaacctgagggaatatcgatggttgcg
cttgggctgttccaacagttgttcaccttagggcgagaggagatcatcagtcatcccagt
gagagtcaggagtcgagtgattccgtgggaatggagcacctttggaagattgccctgagg
gcgcacaatacggacgtctctttgacggccattcagtacatcaacacttactacatggag
aaacagctcaagtatgagaaccaatttgtagcccagtgcatgacccacttgacgcaggct
gtggaagagttggaccgccaaggcccaggctcggagaatgctctcatgtgcgttcagaga
gctctgatgcttctgaacacccatttggaaacgttccggagaagatacgcttaccatctg
aggaggtgggctttggaggggaaggaagtcggtatgcacagtgctttgcgaaacgaaggt
cccggtcctccaatacgaatcgtcctacaacccgcaggagtaccggagaaatccgttctt
catcttcacgcaacggatctggtggcggatctgaaagccgagatcgccaagtggtgggaa
accatccaaggctcggtcaaaactgctcacaacgaaactgtcctaggccttctccttagc
gaagggcccctgcggataatcacccaaggtcaggaaatcactgccgaatacgacgaacgc
agtttggctgacgtcggcttcaaggacaaccaaatggtgtacgtctcgatgggaagtcgc
ggaggtcgtcggcgagaccatcatgaccacccttccatgcaacctccgcccccgaaagac
tgtcttccaacgcttctgcttcttaaaagcccatacttcgagcagctcttcaaactgatg
caaaccctaggcgatatgaagctgatcggccccggaggtcgaatccaacccaacacaaaa
gcgcagctactctcccgaagggtttgggacatccttgccatgcttcccaccgctccaacc
ttcctttcgactttgaagaacctatccttcaaagaccccgactcggaaccttcgatcgac
atggattctccggacaacccaacgtacaccctccaggaaatcctggaaccgcgcaatctc
cagaagttcatgtactcgcttcacatcgtggagagcctctgcaagtccaagttcatgggc
agctgttgcggaggcagcccggcaggtgccccaagccagctgaagctgaagatttcctcg
tccaagtcgttgaagctgcagaatcagaagttggccaaacagcaagctcaggtgttgggg
gtcagtaatagcaacgttggcgggatggtttctccgagcaagttgagcgtttcgccgtcc
ggtggcgaacggaagatggacgtttgcgatggtggggaggggaagacgggggaagtggag
aacaaggaaaataacggcgcggaaggtgcgtcttcgccggagaagaaggacgaggagaaa
gaagggatccctcagctatcgccaccgatggcccatccaacgccgccccctccgaagctc
cccaccagtccggccagcgcttcgctcgagtggagcgaacagttcatcaaatgcggcggc
ctggcccatctgtaccagatcttcatatcgggcgtgctgcagaagcaatccgtggccaag
gatggggacgacctgaacgagtggcgccacgattgtctggccagtctgctgcggatcctg
tgtctgctggggatggaggagttcaaaccggagaacgagaacgccatcatcattccgaag
ctgaaccggcacacgttggccctgatggaggtccggcccacgctggaacggatagcgggc
attctgaacgaggagtcccatccgttgagtccacatcacttcaagacgggactgtttggc
cgggcgcaggtcatccattatgcgatgaatcttctggtttgctacgctcattcgctggcc
gaggtcaggtctacgttgtggaaggtggatgccaatctagcttgggtacaacggctgatc
ctggatgatccggaaccggccgtacggagagaagcatgcgcggcactctacaggatgtgc
ttgggcaacgctcaaacctattacgaacttatggcaccgctgctgtccaagttggttgcc
ctgttgcctctggcggaaaagatgcgtccccaaagtcaggcataccacctgtcgccggat
gaaggcaaagaaccgtatgggcctgcctgtcgagattacttctggttgttgtgtcgcttg
gtggattcgctgtcaccggaacttgtgaaggactgcgggtccatcgggatcgagtccatg
tgcaggcaagtttcgaaaagtatccttgaccgggactaccttgaaagtcgtcacggcagt
ccggatgatggtttgttcgggttgctgaatctgatggccaatttggtcaagttcgatccg
cagttcaagttcagcgatgacggtcaggacttcatcgggaaaatcttccaatcgttgttc
gagcttccctcgcccgatgaccgtgagaagcccaagtgcaaaagccacggtgcgcgagct
gcggcctacgatctgctggtcgagatgtgcaagagtgctcccaagaactatctgctgctg
catgggaagttgatgcaacagcatcgggctggtccccactcgccgtatccctgggactac
tggccaagggatgaaggacgttcggaatgtggctacgtgggtcttacgaatctgggcgca
acctgttacatggcctcgtgcattcagcatctcttcatgacgccccagacgagggatgcg
attctgtccatatcgccggatgccccacaaaagcacaaggccaccctgtacgagctgcag
cgcatgttcgcctatctgatggagtcggagcgtaaggcctactgtccgcggtcgttctgc
cgggtgtaccagatggaccatcaaccgttgaacaccggcgagcagaaggacatggctgag
tttttcatcgatctggtatcgaagctggaggagatgaccccggagctgaagaccctggtg
aagcgagtgttctgcggagtcatcagcaataatgtcgtgtcattagactgcggacacgtg
agtcgaacgctggaggaattctacacggttcgctgtcaagttgcggacatgcgtaatctt
cacgagtcgctggacgaagtaaccgtgaaggacacgctggaaggagacaacatgtacacc
tgttcccagtgtggcaagaaggttcgggccgagaaacgagcatgcttcaagaaactgccg
caaattctgtgcttcaacacgatgcgatacacgttcaacatggtgacgatgctgaaggag
aaagtcaacacccacttcagcttcccgatgcggctggacatgtccggctacgtggagaaa
acgctgatgcctcagcactatcaggaggaaaagcgaaagtcggaactgaggcgatcggct
tccaggaacgcagcagaaaaggccgagattcagaaacaacagcaaactttggacgaagaa
gactcggaagatttcaacgagcactacgagtacgatctggtgggagtgacggtccacacg
ggaaatgccgacggaggccactactacagtttcatcaaggagcgcaacgaagacagtaat
ccgaaccaccaggagaggtggttcctgttcaacgatgccgaagtgaagctctttgatccg
tcgcaaatagcggcggaatgcttcggaggcgagatgacgagcaaaacctacgactcggtt
acggaaaagtatctggatttcagcttcgaaaagaccaattcggcgtacatgctgttctac
gagtggcgctcgaacaagggctccaacatccagcgggatcaagtcagcaagccatccacg
tgcacttcgggagcgtcgatgacctcgatctccgaacaaccggtaacgtcatcatcgtcc
tccgcatttgccagcagtggtccttgtaccactgcatccatcggtgccagcataagcgaa
aatgattctccgtcggaacttccactcccgtcaccaccatccatcgccgcagtacttccc
ccggtgaacatccgcgatgctgccgaccagactgaacgaatcatcctgaaacatcccggc
gaagcgccatcggtagtagataatctaaataccctaagtaaatgtgatatagatgttaag
ccaagcctgcgaagcactgtgggcgtcgttccatccctggcctcggtgccgggccaaccc
accatttccagtgcgctgcaaccgtgcacctcgtcggccgcggcgccatccggtctgtcc
ctggtcggactgggcaaagaactggaggaatggatctggcaggacaaccgacacttcctg
caggataggaacatcttcgagcacacctatttcaacttcatgtggcaaatttgcggtcac
attccgcaaacgttgctggcgcttccggatattacgtgcattgccgcccagctgtcggta
tcgttcttcatcgagacgttcatccacgctaaggaaaagccgacgatggtcctctgggtg
gaactgctcaccaagcagttcaacgccagccaggaggcttgcgagtggtttctcagccac
atgtcggcggaaccgtggtggcccgtgcaggtcctgatccagtgcccgaaccagatggtc
cggcagatgttccagcggttggtaattcacgtgattcagcgattgaggcaaagtcacagc
gccctctacctgaaggtggaaagcgacgaggatgggaacgaaatcattggcaacgtttcc
tgcgtcacccggttcatcaagtcgttgataatgctgatggagcacggagcgcgggcccat
ctgcgccatctgtcggagttcttcgggctgctgtacgagttctcccgaatgggcgaggag
gaagctctgttcctgctgcggatcaacgtgatacgaagcgtggcggatttctacctcggc
cacaaggcgcaggattgcatcgacaccaactccgacaacgaggacaactcgtccgatgag
gctctaacggttgacaaaagccgaccggcgtcgctggataagatgattgctttggtggca
tcgctggtagagcgatcccgaggaccggatctgcgtctgcacctgtccgctcgggactac
aatgccatcgcaggcgggaaagggtttccattcctgtatcagcaaatcaaggacaacatc
aatccgcatcagacgaggcacttgatccatgcgttgtgtcgatgtgacgaacggttagcc
gggcagatcatcgcgatgctgttcacggccgtgacgaagcacaccgaactttgcgggccg
ttcttcaagctgttgacactgttgactgagtctaccgggggtccttccgggttgccatgt
ttttcgcagctggtactgcaacgggtttgggatgccgccgaatactgtccgcagtcagct
ctggattggttggccgtgcaagcccctcggaacaaaattgctcacacctggatcctccag
tctgccgaaagttgggtcgaaacgttcctgctcgcgcacaacaatgctcgggtgcggaac
gccgcggcctatctcctagtatcgctggtcccgtcgcaaaacttccgaaccaatttccgc
gccacgtctcatcacaaactgacgatgcatgcctcccagccgagggaaatttcctgcgaa
gctcagctcatcctgcacacgatactgaatctcctgcttcgactgctccggtccgcccgg
aactacacggacatcagcgtccacgggacgaccaagttgacggcctacttcaacctgatg
acgtactgtttggtgtccaagacggagaagttgatgctgggtccccatttacgagctttg
tgggaactgttccatcctcggttatcggaaccatcagttccggcgcaccacaacaaacag
gcgctcctggcgttctggtaccaagccacgctcgattgtccggagaacgcccttctcgtt
gccaattgtccagacatcaccagaaacattgcatttaactacatcctggccgaccacgat
gactcggagatcgtcacctacaatcgagcgatgctccccgtttactacgggctgcttcga
atgtgctgccaacagagccgactgctgacccgtcagctggccgcccatcagaacctccag
tgggcgttcaagaacatcactccccatcccacgcagtatccgctggccgtcgatgaactg
ttccgattgatgacgctctttgcacaacggcatccggatgccacggaagcggaacaacgg
gaggttaccatcttccggaggacaaccctaactgcatacctgagcggcctggacgcccgg
gtgtcgtggggtacgttgatagcagcactgcggatcctggtcgacaacgacgacgatcga
ctgttcgtcgtcctgaacggaggcatcacgctatgcttcgacgcccttcacacgttacac
tccatgtatcatgaggctaccgcttgtcacgtgttcggtgacctgcaagaactgctaacc
gaagtcatactgctcatcagcactctgcgggccagctgtcgagagcagaagaaacgtcca
ccgccggcactgatgaagggcctcccggacgcagtccggaggctagccacgctcctgaac
acgttcaacccaccggagatgcgcaatctcgccctggaagtgctcaaagaactggtcaag
tgtgccccgccggagatcatcagcaccgtcttggttccactgctaacccactgccacact
cagaacgttgcccacacgatgggacccttgggatcttacttcccacggcgcggtatgaaa
gcgcaatggccaccggtgtcgaagaacacgccgcgtccgcctcggcccatggtccagatg
aacataccgcagtcgcagatttgcgagaagggtctcgacaaggacttcgatctcgcgctg
gagctgttctaccgtccgtaccacgagtttctcgacatcatgttccgggtggcggtcacg
tccagccagttcaacgagccgctcgtgcacctgtcgctgctgaccgggatcgaagccgtg
gtgttgcatttcaacatctttgccaagttctgggttggcatctataacaacaaaaccacc
aataggtacgctgagctgctgatcaagaacccattgctggtggattacatcgatgagatt
ctgagagacgaaagactgtcgctgaacgatccggttattgcgaactttatcgaaatctac
tacccgaaggtgaaatcccggctggtcgtgccccgattgctggagtctatctgccaactg
ctgccggacaagggtaacctcgaggacatttgcggcgatctgcaagcgatacgaatcatc
ggacagcggacgggtattcccggttcggtgaaaacgctgctgcagaactcgctgcacgcg
gtt

DBGET integrated database retrieval system