KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL012055Help
Entry
AaeL_AAEL012055   CDS       T01053                                 

Definition
dfg10 protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AaeL_AAEL012055
    1.3.1.94  polyprenol reductase
     AaeL_AAEL012055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 313 aa AA seqDB search
MIDSLLDLRSVNLINFLFVQLIVIIVVLGGLIATIEKYLPTAIRQTFRYGKHALKGPQDR
LVSLLEVPKSWFKHFYVFAAVWSTAGFYFMASNYFAGQPAPSYVIDFLDIMATTKRTART
TPTETMVAITLITLQCWRRFYETWFVQVFSNKLKMNLSAYLVGYIHYFGTVVVILSQAEG
FIRSDGLPLPYRFELTPRLAFWTGVFFYAWRYQFQSNLILANLRKDRTGKVTNQKHSIPR
GGYFELVSSPHMFFEIVMYVALYAITARNTSAVYVLAWVLSNQTMNAWLTHQWYRENFAD
YPARRRAVFPHVL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattctttgctggatctacgctcggtcaatctgatcaattttctgttcgtgcag
ctgattgtgattattgtggtgctgggcggtttgattgccaccatagaaaagtatttgcca
accgcaatcaggcaaacgttccgctacgggaaacatgctctcaagggaccccaagaccgt
ttggtgtccctgttggaagtgccgaagtcatggttcaagcacttctacgtgtttgctgcc
gtttggtccacggcagggttctacttcatggcgagcaattacttcgctggacaacctgca
cccagctatgtgattgacttcctcgacattatggccaccacgaagcgaactgctagaacc
actcccaccgaaacaatggtagccatcaccctaataacgctacaatgctggcgaaggttt
tacgaaacttggtttgttcaggtgttttccaacaagctgaaaatgaatctgtccgcctat
ctggtgggatacatccactactttggcacggtagtcgttatcctttcgcaagccgaagga
ttcatacgttcggatggcctcccactgccatacaggttcgagctgaccccccggctagcc
ttctggaccggtgtgttcttctacgcctggcgctaccagttccagtcgaatctgattctg
gccaacctgcggaaagaccgcaccggaaaggtgaccaaccagaagcactccataccgcgg
ggtgggtacttcgagctggtgtcgtcaccgcatatgttcttcgagattgtgatgtacgtt
gccctgtatgcaatcacggcgaggaacacgtctgcggtgtacgtgcttgcatgggtgcta
tccaatcagacgatgaatgcatggctgacgcaccaatggtatcgggagaatttcgctgac
tatccggcccggagacgtgccgtgtttcctcatgtgttgtga

DBGET integrated database retrieval system