KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL012146Help
Entry
AaeL_AAEL012146   CDS       T01053                                 

Definition
ubiquitin specific protease
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AaeL_AAEL012146
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AaeL_AAEL012146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 803 aa AA seqDB search
SKKIADCFQVKELIDVKILVDLTKSNCGPEVDNLQAVPKLRVWFLQNLHKASKTMAVKCV
AEVPHSQPKYDINQMIEHIEMLLANPEAIRDDIEGVKKLCEQIVLYLAHTPLRKDMQLEK
LRHFLQKVSYHVPKQHTVEIVEVCLKTLYKHMVSDEETSIYASVVLDLLDKKELIKQGVQ
WIFQQDNDTKAIKKVFKTLMSWLTANNQANDLVTWISEIITGLQELQKHDVLLELSCSSV
KSCSMYFQKHGYQTIMCSILFHILATVEHSPDVFHMIIPIAPTILLELGKQKEKSTELGD
DYQQRFIDILTCLMIRFPDPEHQYRELKECLKSYPRSTNFRPNSVMTSANARVGLVNLGN
TCYMNSVLQALVMTKQFSREILLSKIDAPLFDQIQELLALLIHSHRQELNPRALLAAARP
PDFVPGYQQDSSEFLGYLLEKLHEQEKQLINKRQRPTATEDQSLLVKLPSENPNTMTIEQ
NSIVSEARTTPQDTTLNETLLRPTLIQRMFDGKLFVTYQCGVCDSKSTNLDAIRSFELSF
PESNGIKTEYSVQKLLDFYCSSEKLIGDNQYYCDKCKQLCDGERSIRITKSPRNLILTLK
HFRYDLHRHTRAKLMNQVQHNETISLRVTPEEGHPFVVQYSLYAAVVHAGTSMDSGHYYT
YAQDEPDCWYKFNDNYVTGCSVDELHALSSPNTPYILFYQMSAPSTDCTMSLCIDDEMEH
NASANLALVSTDDVPDCQLPRLEELPPRLRDLVHIHNQTYKEEKRITTQKRFEVHPMNRD
TDDDPPPNSCGSNSFNYPNRFIY
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
tcgaaaaaaattgcagattgctttcaggtaaaggaattgatcgatgttaagattttagtg
gatcttactaaaagtaattgcggaccggaagttgataatctccaagctgttccaaaattg
cgtgtgtggttcctgcaaaatctgcataaagcaagtaaaaccatggcagtcaagtgcgtt
gcagaggtacctcacagtcaacccaaatatgacataaaccaaatgattgaacatatcgag
atgctgctagcgaatccggaagccattcgagatgatattgagggagtcaaaaagttgtgc
gagcaaattgttctgtaccttgcacatactccgttgagaaaagacatgcagctggaaaaa
ttgcgccatttcctgcagaaagtttcgtaccatgtacctaaacagcacaccgttgaaatc
gtcgaagtgtgtttgaaaactctctacaaacatatggtttctgatgaagaaacatctatt
tatgcttcggtcgtactggacctcttggataagaaagaactgatcaaacagggcgttcaa
tggatttttcaacaggacaatgatacgaaggctatcaagaaggtattcaaaacgttaatg
tcctggttaacggccaacaatcaggcaaacgaccttgttacttggatttctgaaatcatc
actggccttcaagaacttcaaaaacacgatgtgcttctagagctttcatgcagttcagta
aaatcgtgttcaatgtattttcaaaaacacggttatcaaacaattatgtgttccatattg
ttccatatactggcgactgttgaacattcgcctgatgttttccacatgatcattcccata
gctccgacaatactgctagaattgggcaagcaaaaagaaaagagcactgagctcggtgat
gactatcagcaacgatttatcgacattcttacatgtttgatgatacgatttcctgatccc
gagcatcaatacagagaactgaaggaatgtttgaaaagctatccgcggtcaactaacttc
cgaccaaattcagtaatgacctctgctaacgcaagagttggattggtgaatcttgggaac
acatgctacatgaacagtgtattgcaggctttagtaatgacaaaacaattcagccgagaa
atactgctgtctaaaattgatgctccgttgtttgaccaaatccaggaactactagctctg
ttgatacactcacatcgtcaggaactgaatccccgagcattgcttgccgctgctcgccct
cctgacttcgttcctggctaccagcaagactcgtccgaatttctggggtatttgctagaa
aaattgcacgaacaagagaaacagttgataaataagcgacaaaggcctacagcaactgaa
gatcaatctctgttggtaaaattaccttcagaaaatcccaacacgatgacaatagaacag
aacagcattgtcagtgaagcccgtactactccacaggatactactttgaatgaaacccta
cttcggccaactctcatacagcgaatgttcgatggaaagctgtttgttacataccagtgc
ggagtttgcgactcgaaaagtactaatctcgatgctatacgatcattcgaactatccttc
ccagaatctaacggcatcaaaacagaatactccgtgcaaaaattgcttgatttttactgt
tcctcagaaaagttgataggcgataatcaatattactgtgataagtgcaagcaactttgt
gatggagaacgttcaataaggattacgaaatcgcctagaaatctaatcctaacgttaaag
catttccggtatgatctccacagacacacgagggcaaagctgatgaaccaggtgcaacac
aatgagaccatatcgctaagggtaactccagaggaagggcatccttttgttgtacagtac
tcattatacgcagcagtggtacatgccggaactagtatggactccggccactactacaca
tatgcgcaggatgaaccagactgctggtacaagttcaatgataactacgtaaccggatgt
tcagtggatgagttgcacgctctatctagtcccaataccccgtacattttattttaccag
atgtccgctccatccactgattgcacgatgagcttatgcatagatgatgaaatggagcac
aatgcttcagcgaatttggctttggtttccactgacgatgttcctgattgtcagcttccc
cgactggaagaacttcctccgcgtttgcgagatttggttcacatccataatcaaacatac
aaagaggaaaaacgcatcacaacgcaaaaacgtttcgaggtacaccccatgaatcgcgac
acagacgacgacccaccgccgaattcttgcggaagtaattcttttaactatcctaaccga
ttcatctattaa

DBGET integrated database retrieval system