KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL012269Help
Entry
AaeL_AAEL012269   CDS       T01053                                 

Definition
serine/threonine kinase NLK
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    AaeL_AAEL012269
   04068 FoxO signaling pathway
    AaeL_AAEL012269
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AaeL_AAEL012269
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AaeL_AAEL012269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 320 aa AA seqDB search
INFAPTSYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPG
NLLVNSNCVLKICDFGLARVEEPDQSKHMTQEVVTQYYRAPEILMGARHYSAAVDVWSVG
CIFGELLGRRILFQAQSPVQQLELITELLGTPTLEDMRHACEGARTHMLRRAPKPPSLSA
LYTLSTHATHEAVHLLCQMLVFDPDKRISVIDALAHPYVDEGRLRYHSCMCKCCYTPSAG
MRQYAAEFEPSAPQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTNRVPLCINPQSAAFKS
FASSTVAHPSELPPSPHQWE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atcaatttcgcaccaaccagttacgtcatcacagagctgctacagtcggatctgcacaaa
atcatcgtatcaccacagcacctatcggcggaccatatcaaagtgttcctgtaccagatc
ctgcggggtctcaaatatctacactcagcacgaatcctgcaccgggatatcaaaccaggc
aacctgctggtgaacagcaattgtgttcttaagatttgtgattttggattggcacgcgtg
gaagaaccggaccagtcgaagcacatgacacaggaagtggtaacgcagtactatcgcgcg
ccagagattctgatgggagcacgacactattcggcggccgtagatgtgtggtcggttgga
tgcatattcggagaactactcggcaggcgaattctatttcaggcacagagtccagtgcag
cagctggaactgataacagaactgctgggcacacccacgctagaggacatgcggcacgcc
tgcgagggagccagaacccacatgctgcgaagagctccgaagcctccgtccctgtccgca
ttgtacaccctgagcacacatgccacccacgaagcagtgcacctcctctgccagatgttg
gtcttcgatccggacaagagaatatcggtgattgatgccctggcccatccgtacgtcgac
gagggtcgccttcgttaccattcctgtatgtgcaagtgctgctacaccccgtctgccgga
atgcgccagtatgcggccgaattcgaaccctccgcgccacaaccgttcgatgacctctgg
gaacggaagctgacttcggtgcagcaagtcaaagaggaaatgcacaaattcatagccgaa
cagctgcaaacgaatcgcgtgccactatgtataaatcctcagagcgccgcatttaagagc
ttcgccagctctaccgtggctcatccttcagaactgcctccctcgccgcaccaatgggaa
tga

DBGET integrated database retrieval system