KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL012279Help
Entry
AaeL_AAEL012279   CDS       T01053                                 

Definition
eukaryotic translation initiation factor 3 subunit 1 (eIF-3 alpha)
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL012279
Translation factors [BR:aag03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AaeL_AAEL012279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 241 aa AA seqDB search
MEEDWEQLSEQEKVPIPAKKPDVNKWDGEDEEEEVKDSWEDEDELEEKKDEEKVETPKAK
PKKTLQQKIADKEKLKQEEAERRRLEKEEEDMTPEQKLAEKLRLQKLQEESDLKNALDTF
GVTSIVGGIDGMHPTNKEEFIELSDAICKKLSNYKNDTEYCAFLEDLVTKLFASLPSANI
RKVKGILDNLYLEKQKLEKGDKPKKKAGGKIKARLRMDGENQNFDEYAPKYDDFDEYDDF
M
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagattgggagcaactcagcgagcaggaaaaggtgcccattcctgccaagaaa
ccggacgtcaacaaatgggatggcgaggatgaggaggaagaagtgaaggacagttgggaa
gatgaggacgagcttgaggagaaaaaggatgaggaaaaagtggaaactcccaaagctaag
ccgaagaaaaccttgcaacagaaaattgccgataaagagaaattaaagcaagaagaagct
gagcgacgaaggttagaaaaggaagaagaggacatgactcccgagcagaaattggctgaa
aagctccgacttcagaaattacaagaggaatctgatctgaagaatgccctggacacattt
ggagtgacgtccattgttggcggaatcgatggtatgcatcccaccaacaaggaggaattt
atcgaactttccgatgccatctgcaagaagctttcaaattacaaaaacgataccgagtat
tgtgcgtttttggaggatcttgtcaccaagttgttcgccagtttgccatcggccaatatt
aggaaagtcaaaggtattctggacaatctttatctagaaaagcagaagttagaaaagggt
gataagcccaagaaaaaggcgggcggaaagattaaggccaggctacgaatggatggcgaa
aatcaaaactttgacgaatacgctcctaagtacgacgatttcgatgagtacgatgatttt
atgtaa

DBGET integrated database retrieval system