KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL012562Help
Entry
AaeL_AAEL012562   CDS       T01053                                 

Definition
circadian locomoter output cycles kaput protein (dclock) (dpas1)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:aag00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    AaeL_AAEL012562
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AaeL_AAEL012562
Transcription factors [BR:aag03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    AaeL_AAEL012562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 900 aa AA seqDB search
MEDDPDDKDDTKRFVVYDSKSRNLSEKKRRDQFNLLVNELSSMVSSNSRKMDKSTVLKST
IAFLKSHNEIAVRSRVHEIQTDWKPSFLSNEEFTHLILEALDGFIIVFSSTGRVFYASES
ITSLLGHLPSDLLNMTVYDMVYEDDQNDLYNILLNPAAVVDPLQTGISRENQVTFSCYIK
RGTADYRTEVSYELVQFTGYFSEYDRWSSCGSDVDADSLMTTSRFSGYMTDADTRLIFVG
TGRLQTPQLIREMSIVDSSKSEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYY
HFDDLEKVVSCHEALMQKGEGTSCFYRFLTKGQQWIWLQTRFYITYHQWNSKPEFVVCTH
RVVSYADVMKQMRNQAGGEGKFSEDTDSVSIGVERKFQPSSSQSLLATSPWSSKSSRTSR
IAPTPGGSPTGAPSRGRHRYNTYQGPGSDSATSMSAESHVSRQSMMTQHSSVIRSNTFHS
KPSSQDGSSQHTAAHFILQQQMMPNPQQPSPESFQQMLATTQHQIRPPPAAAIITPPVTQ
IISPAGFIEPQQYLAAIPVQPVAGFPPDSSTGVLSPIPPTSPAAYAVHPTVPSAAGSVVL
TPAQNQVQDQLQRKHEELQHLIMHQQEELRRVQEQLLMARYGLLPSIVTLPFTSASSSTI
DISSRCSSSTSYLQHHQSSHSSHQYPTHPSLANQPQNLLNPQPHQSQQQPDQQMSIPLDQ
KPIFHPNQQLNFTDTGQPKLPGDPNSEAISYMQLTPVPIHHLQQQSQPLQQQQQHHHQMQ
NPGMNLPGPSGNSMELLQYQMAEEQAQTLFTSGMEQQQQQQQHLPQPQQQHHHHQQQQQQ
QMHHQHSHHHQHHHQHHHHQQQQQQQQQQPQHHQSQHHHSQSSSVGSPGGSTRSHPRSDM
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgatccggatgacaaagatgataccaaaaggtttgttgtatacgattcgaag
tcccggaacctcagtgagaagaaacgccgtgaccagttcaacctgttggtcaacgagctc
agctcgatggtgtcgtccaatagccgcaagatggacaagagcacggtgctcaagtcgacg
atcgcattcctgaagagtcacaacgaaatcgcggtccggtctcgggtgcacgagatccag
accgattggaagccttcgtttctgtccaatgaggagtttacgcatttgattctggaggcg
ctggatgggttcatcatcgttttttcatcgacgggtcgggtgttttacgcatcggagagt
ataacgtcacttctgggtcatctgcctagtgacttgctcaacatgaccgtgtacgatatg
gtgtacgaggacgaccagaatgatctgtacaacattctgctgaatccggcggcggtggtg
gatcctttgcagacgggaatctcccgtgaaaatcaggttaccttttcgtgctatatcaag
cgtggtacggctgattaccggacggaggtttcgtacgagttggttcaattcaccggatac
tttagtgagtatgatcgctggtcaagttgtggaagtgatgttgacgctgattccttgatg
acaacgtcgcggtttagtggttacatgaccgatgccgatacgaggttgatcttcgtgggg
acgggaaggctgcagacgccccagctgatcagggagatgtcgattgttgatagttccaag
agtgagtttacttcgaggcacagcttggagtggaagtttctctttctggaccatcgggca
ccgcccataattggctacctaccgttcgaggtgttggggacttccgggtatgattactat
catttcgatgacctggagaaggtagtttcgtgccatgaagctttaatgcagaaaggagag
ggaacctcgtgtttctataggtttcttaccaaaggccaacagtggatttggctgcaaact
cggttttacatcacctaccatcaatggaactccaaacctgaattcgtggtgtgtacgcat
cgtgtcgtcagttatgccgatgtgatgaaacaaatgcgaaatcaagctggtggagagggc
aagttttccgaagatacggatagcgtcagtataggggtagagcggaagtttcaaccgagc
tcgtcgcaaagtttactggcaacatctccgtggagttcgaagagctctcgtacttcacgg
atagcgccaactccaggaggatcccccacaggtgctccgtcaagaggaagacataggtac
aacacctaccaaggtcctggatctgactcggcaacttcaatgtctgctgaatcacatgtc
agtcgacaatcgatgatgacgcagcatagttcagtgattcgctccaacactttccactca
aagccttcctctcaagacggaagcagtcagcatacggcggctcatttcatactccagcag
cagatgatgccgaatcctcaacagccatctccggagtcttttcaacagatgctggcgaca
actcagcaccagattcggcctcctccggcagctgcaatcatcaccccacccgtcactcag
atcatcagcccagctgggtttatcgaaccgcaacagtatttggcagcgattccggtgcaa
ccagtagcaggatttcctccggactcgtcaaccggcgttctgtctcccattccaccgaca
tctcctgcggcatatgcggttcatcctactgttccttctgcggctgggagcgtcgtgcta
actccagcgcagaaccaggttcaagatcagttacagagaaaacacgaagagctgcagcat
ctgatcatgcaccagcaggaagaactccggagagttcaggaacaattgctaatggcgcgt
tacggcctgttaccttccattgtgactcttccattcacatccgcatccagcagtaccatc
gatattagtagtagatgtagcagcagtacatcatatctccaacatcaccagtcatctcac
agtagtcatcaatatccaacgcatcctagtctggcgaatcagccgcaaaacttactaaac
ccacagccgcaccaatcccagcagcaacccgaccaacagatgtctatacctctagatcag
aaaccgatcttccatcctaaccagcagctcaatttcactgacactggacagccaaagctt
cctggagaccctaacagtgaggctatttcctacatgcagctaactcccgtcccaattcat
cacctgcagcaacagtcacaacccttgcaacagcaacagcagcatcatcatcaaatgcag
aaccctggtatgaatctacccggccccagtggcaacagcatggagctattgcagtaccaa
atggcagaagagcaagctcaaaccttgttcacatcgggcatggagcaacagcagcaacaa
caacagcaccttcctcaaccgcaacaacagcatcatcatcaccaacaacagcagcagcag
caaatgcaccatcagcattcgcatcaccatcagcaccatcatcaacaccaccaccatcag
cagcaacaacaacaacaacagcaacagccgcaacatcaccaatcacaacatcatcactcg
caaagctcttcagtggggtcgccgggaggttccacccgaagtcaccccaggagcgatatg
tag

DBGET integrated database retrieval system