KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL012723Help
Entry
AaeL_AAEL012723   CDS       T01053                                 

Definition
mitogen activated protein kinase kinase 2, mapkk2, mek2
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:aag04013]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aag04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:aag04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 404 aa AA seqDB search
MSKMTKNKLNLTLPPGSVDVTASQQTTPTPSFKTPSGTEYVIGKHNLLGKPKNSIDALTE
TLEELEIDENARKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHIPTELIMA
RKLIHLEVKPAIKKQIIRELKVLHDCNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLIL
KRAGRIPEPILAKITCAVLKGLSYLRDKHAIMHRDVKPSNILVNSSGEIKICDFGVSGQL
IDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDAKMLDYIF
QDKGDDSSPGQNIIEPKPMAIFELLDYIVNEPPPKLEHHSFTDRFKDFVDRCLKKNPEER
ADLKTLINHDWIKNIEQEDVDIAGWVCKTMDLLPSTPKRNASPN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatgactaagaacaaattaaacctaacgttgccgccgggttcggtggatgtt
acggccagtcagcaaacgactccaacgccctccttcaagaccccatccgggacggaatat
gtcatcgggaagcacaacctgctggggaagccgaagaatagtatcgatgccctgacggaa
acgctggaagagctggaaatcgacgagaatgcccggaagcggataaaggtcttcctgagt
cagaaggagaagatcggggaactgagcgatgaagatttggagaagctgggcgaattgggt
tccggaaacggcggggtagttatgaaggtacgacacattccgaccgagttgataatggct
cgaaagctgatccacttggaggtcaagccggccatcaagaagcagattatccgggagttg
aaggtgctgcatgattgcaacttcccgcacattgtcggattctacggggcattctacagc
gatggggagatcagcatttgcatggagtacatggacggggggtcgttggatttgatcctg
aaacgggccgggcgcattccggaaccgattctcgctaaaattacctgcgccgtactgaag
ggactgagctatttgcgggataagcatgccatcatgcatcgggacgtgaaaccgagcaat
atcctggtgaatagtagcggagagattaagatctgtgatttcggagtgtccgggcagctg
atcgattcgatggcgaactcgttcgtgggcaccaggagctacatgtcgccggaacgcctg
cagggcacccactactcggtccagtcggacatttggtcgctcggtttgtcgctggtcgaa
atggccatcggaatgtacccgatcccgcctccggatgccaaaatgttggactacatcttc
caggacaaaggcgacgatagttcacccggccagaacatcatcgaaccgaaaccgatggcc
atcttcgagctgctggactacatcgtcaacgaaccaccgcccaagctggagcaccactca
ttcaccgatcggtttaaggactttgtcgatcggtgcctgaagaagaaccccgaggaacgg
gccgatctcaagacgctaatcaaccacgactggatcaagaatatcgaacaggaggacgtg
gacattgccggctgggtgtgcaaaactatggatctgctcccatctacgccgaagcgcaac
gcgtcgcctaattaa

DBGET integrated database retrieval system