KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL012723Help
Entry
AaeL_AAEL012723   CDS       T01053                                 

Definition
mitogen activated protein kinase kinase 2, mapkk2, mek2
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AaeL_AAEL012723
   04068 FoxO signaling pathway
    AaeL_AAEL012723
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    AaeL_AAEL012723
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AaeL_AAEL012723
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AaeL_AAEL012723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 404 aa AA seqDB search
MSKMTKNKLNLTLPPGSVDVTASQQTTPTPSFKTPSGTEYVIGKHNLLGKPKNSIDALTE
TLEELEIDENARKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHIPTELIMA
RKLIHLEVKPAIKKQIIRELKVLHDCNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLIL
KRAGRIPEPILAKITCAVLKGLSYLRDKHAIMHRDVKPSNILVNSSGEIKICDFGVSGQL
IDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDAKMLDYIF
QDKGDDSSPGQNIIEPKPMAIFELLDYIVNEPPPKLEHHSFTDRFKDFVDRCLKKNPEER
ADLKTLINHDWIKNIEQEDVDIAGWVCKTMDLLPSTPKRNASPN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatgactaagaacaaattaaacctaacgttgccgccgggttcggtggatgtt
acggccagtcagcaaacgactccaacgccctccttcaagaccccatccgggacggaatat
gtcatcgggaagcacaacctgctggggaagccgaagaatagtatcgatgccctgacggaa
acgctggaagagctggaaatcgacgagaatgcccggaagcggataaaggtcttcctgagt
cagaaggagaagatcggggaactgagcgatgaagatttggagaagctgggcgaattgggt
tccggaaacggcggggtagttatgaaggtacgacacattccgaccgagttgataatggct
cgaaagctgatccacttggaggtcaagccggccatcaagaagcagattatccgggagttg
aaggtgctgcatgattgcaacttcccgcacattgtcggattctacggggcattctacagc
gatggggagatcagcatttgcatggagtacatggacggggggtcgttggatttgatcctg
aaacgggccgggcgcattccggaaccgattctcgctaaaattacctgcgccgtactgaag
ggactgagctatttgcgggataagcatgccatcatgcatcgggacgtgaaaccgagcaat
atcctggtgaatagtagcggagagattaagatctgtgatttcggagtgtccgggcagctg
atcgattcgatggcgaactcgttcgtgggcaccaggagctacatgtcgccggaacgcctg
cagggcacccactactcggtccagtcggacatttggtcgctcggtttgtcgctggtcgaa
atggccatcggaatgtacccgatcccgcctccggatgccaaaatgttggactacatcttc
caggacaaaggcgacgatagttcacccggccagaacatcatcgaaccgaaaccgatggcc
atcttcgagctgctggactacatcgtcaacgaaccaccgcccaagctggagcaccactca
ttcaccgatcggtttaaggactttgtcgatcggtgcctgaagaagaaccccgaggaacgg
gccgatctcaagacgctaatcaaccacgactggatcaagaatatcgaacaggaggacgtg
gacattgccggctgggtgtgcaaaactatggatctgctcccatctacgccgaagcgcaac
gcgtcgcctaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system