KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013052Help
Entry
AaeL_AAEL013052   CDS       T01053                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AaeL_AAEL013052
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AaeL_AAEL013052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 228 aa AA seqDB search
MTTWLPLESNPDVLNKYLEKLGVSPLWNIVDIYGTDEELLAFVPQPLKSLIFLFPCSDAY
EEFRAKEDAELKAKNIEHPKSLFYMRQYVHNACGTIALVHAVLNNPEIELTEGSVMKKYW
DAAKDKTPEERGKLLGNDTGFTETHEVIANEGQTPAPDINEKVYHHFIAFVHHEGKLYEL
DGRKNFPIQHGETSPEKLLHDAIAVCKEYIARDPKEVRFTMLGLAPTQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttggctgccattggaatccaatccggatgtgttgaacaaatatctggaaaag
ctgggcgtttcacctctctggaacatcgtcgacatctacggcacggatgaggagctgctg
gcttttgttccgcagccgctcaaatcgttgattttcctgtttccctgctcggatgcgtac
gaggagttccgcgccaaagaggatgccgagcttaaggccaagaacatcgagcacccaaaa
agtctgttctacatgcgtcagtatgtgcacaatgcctgtggcacgattgccctggtccat
gccgtgctgaacaatccggaaatcgaactgacggagggaagcgtgatgaagaagtactgg
gacgctgccaaggataaaaccccggaagagcgtggcaagctgctggggaacgataccgga
tttaccgaaactcacgaagtaattgccaacgagggccaaacgccggccccagacatcaac
gaaaaggtttaccatcatttcattgccttcgtgcatcacgaggggaagctgtacgagctg
gatgggcggaagaacttccccatccagcatggagaaacgtcgccggaaaagctgctgcac
gatgcgatcgccgtttgcaaggaatacattgcccgcgaccccaaggaagtccggttcacc
atgctgggtttggccccaacccagtag

DBGET integrated database retrieval system