KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013170Help
Entry
AaeL_AAEL013170   CDS       T01053                                 

Definition
phosphatidylcholine-sterol acyltransferase (lecithin-cholesterol acyltransferase)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AaeL_AAEL013170
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AaeL_AAEL013170
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AaeL_AAEL013170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 425 aa AA seqDB search
MRLISVLLLLMVAATAYGTIFGSGVKFVTDLHKKLRRRYDERFERRLSPVIFVPGDGGSQ
MDAIINKKDSVHFYCQKSSSTYFNIWLNKELLVPFVIDCWIDNIRLVYNSTTRKTSNAPG
VETRIPGFGSSETVEWIDPSHASEGAYFVNIGNALVQNGYKRDLSIRGAPYDFRKAPNEN
KEWFIKLKHLVEETYTLNDDTPISFIVHSMGGPMTLLFLQMQTQQWKDQYIRRVISLAGA
WGGSVKALKCFAVGDDLGAFALSGKVMRAEQITNPSLAWLMPNPLLWKPNEVMVRSLSRT
YTMDQLEEFFQDLDYINGWEMRKDSLEYSLNFTAPGVELHCMFGSGFNTVESLNYEKSYD
FSGKPTLVYGDGDGTVNRRSLEACRHWSSQQKQPIYMREFPGADHMNILADLSVLDSIIK
VLMYD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgattaatttcggttttgttgctgctcatggtggcggccaccgcttatggcacgatt
ttcggatctggcgtgaaatttgtgacggatctgcataagaaactgcggcggagatacgat
gaacgcttcgaacggagattgtcgccggtaatttttgttcccggagacggaggtagccaa
atggacgccatcatcaacaagaaagactcggtccatttctattgtcagaaatcttcgagc
acctatttcaacatttggttgaataaagagctcctggtcccatttgtcatcgactgttgg
atcgacaacatacgcttggtatacaatagtaccacgagaaaaacttcgaacgcacctggt
gtggagactcgcatacccggcttcggttcgtcggaaaccgtcgagtggattgatccgtcc
cacgccagtgaaggggcatactttgtgaacattggcaacgcattggtgcagaatggttac
aaacgtgatctctctattcggggagcgccatacgacttccggaaagcaccaaatgagaac
aaagagtggttcatcaaactgaaacacctggtcgaggagacttacaccttgaacgatgac
accccaatctcctttatcgtgcatagcatgggtggtccaatgacgttattgtttcttcaa
atgcaaactcaacagtggaaggatcagtacattcgacgtgtaatttccctggcgggtgct
tggggcggaagcgtaaaagccttgaagtgctttgctgtgggtgacgatttgggtgctttt
gcacttagcggtaaggtaatgagagcagagcagattaccaatccttcactggcttggctg
atgcctaacccattgctgtggaaaccaaatgaagttatggttaggtctctatccagaact
tacaccatggatcagttggaggaattctttcaggatcttgattacatcaacggttgggaa
atgagaaaagacagcttggaatattcactcaatttcaccgcaccaggtgtggaactgcat
tgtatgtttggctcagggttcaacaccgttgaaagtctaaactacgaaaaatcgtacgac
ttctccggtaaacccacactagtttacggagacggtgatggaaccgttaatcgacgttcc
ctcgaagcgtgtcggcattggagtagccaacaaaagcagccaatttatatgcgcgaattt
cccggcgctgaccatatgaacatcctggcagatttgagcgtactggacagcatcatcaaa
gtactaatgtatgattag

DBGET integrated database retrieval system