KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013214Help
Entry
AaeL_AAEL013214   CDS       T01053                                 

Definition
cgmp-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     AaeL_AAEL013214
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   AaeL_AAEL013214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 966 aa AA seqDB search
MHLIDRLVPGSYIVAHWFDPVRLSRRIYEQEFNPIANGTSRTVGKFSPKGTERESGLGSL
DERLNLPNGTPWEARPVSVPQPQFERKTPLPTVKDRISASSQEPDRNVNFELLKEIQQTK
ILLQLALESKLREHPNNDDRHQLVKLEKEIKELQNRISKSTIVPEPVQESVIVRQNAHPT
ARASPQPSHGPPRPNLPPPKSSLSRQISTIPTQAWEASETSDDYDTIPPSKSKVQSVPEV
TSSEEEDEDEEIPDTQDDTSQDEEPTPPKLPPPRVPSMVDDMISLSVPLSMVSNEIEKAQ
QAPPVPSGPPPKRMPPPTPEKEVTLGTPTQRDSEDSLPPPKIEELNSSRTAGILKKVRKE
GVLSDKTEVKGSREIVIPSHPKRTDDELLIRKAITANEFLNNLMDEERLKAVTDAMSPMT
FPPNSYIIKEGDIGAHFFVSADGTYEVVAENKVIKSFGRGVVFGELAILYKAKRFASIRV
TTEAKVWMLERKVFQKIMMKSGRKEREENVKFLSTVSILKDLQTEKLHKISDLLKREFYA
TGSTIIQQGDPGDKFYIIRGGSVNVIKTDRHGVDKLVGTLQRGAYFGEQALLHEDRRLAS
IIANPPGTECLTLNRIAFNEFLGGLEQLREIKLSDDLPRISGDKNTSSEYDHIQLHDLTY
IGTLGIGGFGRVELVRYQKQKTFALKYLKKIEMVRQQQQEHAYSEKDIMLSCNSPFIVRL
YKTYRDKKYLYFLMEACLGGDVWTILQKSKHFDERTARFMAGCVVEAFEYLHSRNMIYRD
LKPENLMLDEQGYIKLVDFGFAKRIGANQKTWTFAGTPEYVSPEIILNKGHDRAVDYWAL
GVFIHELLVGKPPFRGKNHMKTYNAILRGIDIIELPSRIPKKAQVLIKRLCRQIPAERLG
YGKNGIADIKNHPWFSGFEWQRLKERTLPAPLVRPIQSDTDLSNFDEYPKDQDEPPDETS
GWDINF
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgcatttgattgataggttggttcctggaagctacatagtggcgcattggtttgaccct
gttcgattgagtcggagaatctacgagcaggagttcaatccaatcgccaatggtacatcc
agaaccgtaggaaaattttcaccgaaaggtacagagcgagaatctggtttgggtagtttg
gacgagcggttgaacttacctaacggaaccccatgggaggcgaggcctgtgtcagttccc
cagccacaattcgaacgaaaaactccactgccaacagtgaaagaccgcatcagcgccagt
tcccaagaaccagatcggaacgttaatttcgagctactcaaggaaattcagcaaactaaa
atactcctccagctggcgcttgaatcaaagcttcgagagcacccgaacaatgatgaccgc
catcagctggttaagctggagaaagaaatcaaagaacttcagaaccgtatcagcaaaagt
actatcgtgcctgaaccagtacaggaatcagttatcgttagacaaaatgcacatccaacc
gctcgggctagtccacaaccttcgcatggtccgccacgtccgaatctcccgccaccaaaa
tcgtcactcagtaggcaaatttcgacgatcccaacgcaagcctgggaagcgagtgaaaca
tccgatgactacgacacgataccaccgtcgaaatcaaaggttcaatccgtcccagaagtc
accagctccgaagaagaagacgaagatgaagaaattcctgacactcaggatgacacctct
caagatgaggaaccaactcctcccaagttgccaccaccgagagtaccctccatggtagac
gacatgataagcctttccgttcctttgagtatggttagcaacgaaatcgagaaagcacag
caagcacctccggtcccatcaggaccaccaccaaaacgaatgcctccaccaactccagag
aaagaagttactcttggtactccgactcagagagattcggaggactcgctacctccgcct
aaaattgaagaactgaacagcagccgcacggcggggatacttaagaaggttcgtaaagaa
ggtgtcctgtcggacaaaacggaagtaaagggctcccgtgaaattgtcatcccaagtcat
ccgaagcggacagatgatgaactgttgatacggaaagctattacggcgaacgagtttttg
aacaatctgatggacgaggaacgattgaaggcagtgacggacgctatgagcccgatgaca
tttccacccaacagctacatcatcaaggagggagacattggggcacatttcttcgtatcg
gcagatggaacctacgaggtagtggcggagaacaaggtgatcaaatctttcggacggggt
gtggtcttcggagaattggctattctgtacaaagcaaagcgcttcgccagtattcgagtc
actacggaggccaaagtttggatgctggaacggaaggtgttccagaagattatgatgaaa
agtggaaggaaggagcgggaagagaatgtcaagttcttgagtacggtatccatattgaag
gaccttcaaaccgagaagctgcacaaaatatcggatctgctgaaaagggagttctatgca
accggatctacgatcattcagcagggtgatccgggtgataagttttatatcatccgggga
ggtagtgtaaatgtgataaaaaccgatcggcacggagtcgataaactggtcggtactctg
cagaggggagcttactttggtgaacaggccttacttcacgaagatcgacgactggccagt
attattgcaaatccccctggaacagaatgtttgacgttgaataggatagcttttaatgaa
tttcttggtggattggagcaactgcgggagataaagctgtcggacgacctgcccagaatt
tctggtgataagaacacttcttctgagtacgaccacattcagctgcacgatttaacctac
atcggcactttgggaatcggaggtttcgggcgggtcgagttggtgaggtaccaaaagcag
aaaacgtttgctctcaagtatctgaagaagattgagatggtacgtcaacagcaacaggaa
catgcctacagtgagaaggatatcatgctgagctgcaatagcccgtttatcgtgagattg
tacaaaacgtatcgtgataaaaagtatttatacttcctcatggaagcctgcctgggaggc
gacgtttggaccattctacagaagagtaaacatttcgacgaacggacggcacgcttcatg
gccggatgcgtggtggaggccttcgagtacctgcacagccgcaatatgatctaccgggac
ttgaaaccggaaaatctgatgctggacgagcaaggctacatcaaattggtggatttcggt
ttcgcaaagcgcatcggtgccaatcaaaaaacctggacttttgcgggcactcccgaatac
gtttcgccggaaattatccttaacaaaggccacgacagagctgtggattactgggcactg
ggcgttttcatccacgaactattggttggcaaaccaccgtttcggggaaaaaatcacatg
aaaacctataacgccattctgcgaggaattgatattattgagctaccgtcgaggattccg
aaaaaagcccaagtgttgattaaaagactttgtcgacaaattccagccgagaggctcggg
tacggcaaaaacggaattgccgatattaaaaaccatccgtggttctcgggctttgaatgg
cagcggttgaaggagcgcaccctaccggctcctctggtgcgcccaatccaatccgacacc
gatctgtccaacttcgacgagtacccgaaggatcaggacgagccaccggatgagacgtcc
gggtgggacatcaatttttaa

DBGET integrated database retrieval system