KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013225Help
Entry
AaeL_AAEL013225   CDS       T01053                                 

Definition
NADH-cytochrome B5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aag00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 318 aa AA seqDB search
MPDFDVVPVAVGVLVVVAGAVIANYLLNSGKKDKSKSSKDDSKKSSGQLRTLVDPQEKYM
LPLIEKEEISHDTRRFRFGLTSSKHILGLPIGQHIHLSATINEELVIRAYTPVSCDDDHG
FVDLVVKVYKKGVHPKFPEGGKMSQYLESLAIGDRIAFRGPSGRLQYLGNGKFSIKKLRK
DPAQIYEADKVSLIAGGTGITPMLQLVREVLKHADTDKTKLSLIFANQTEDDILLKPELD
DLAARYPDQFKLWYTLDRPKPEWTQGQGFITDQMIKEHLFEPSSNTLVLMCGPPPMVNYA
CIPALEKLGYQMERTFAY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcccgactttgatgtcgtccccgtggcagtcggggttctggtggtggttgccggcgcc
gtcattgccaactatctgctcaatagtggcaagaaagacaagagcaaatccagcaaagat
gattctaagaagtcatctggacagctacgaacgctggttgatccgcaggaaaagtacatg
ctgccgctgatcgaaaaggaggaaatctcacacgacacccgtcggttccggtttggactc
acttcgagtaagcacattctggggctgccgatcggtcagcacattcacctgtcggccacc
atcaacgaagagctggtgatccgtgcgtacactccggtgtcatgcgacgacgatcacggt
ttcgtcgatttggtcgtgaaggtttacaagaagggagtgcaccccaagttcccggagggt
ggtaagatgtctcagtatctcgagagcttggccatcggcgataggattgcgttccgtggc
ccatccggacggctgcagtacctgggcaacggcaagttttcaatcaagaaactacgcaag
gacccggcgcaaatctacgaagccgataaggtcagcttgattgctggtggtactggtatt
actcctatgctccagttggtccgtgaagtcctgaagcacgcagatacagacaagactaag
ctgtccttaatctttgctaatcagaccgaagacgacatccttctaaaaccagaattggac
gatttggcagcccgctatccggaccagttcaaattgtggtatacccttgatcgtccaaaa
cccgaatggacccaaggtcagggcttcatcaccgatcagatgatcaaggagcacctgttt
gagccgtcttccaacaccctggtgttaatgtgcggtcccccaccgatggtcaactacgct
tgcattcccgcactagagaagttgggctaccagatggagcgtaccttcgcctattaa

DBGET integrated database retrieval system