KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013253Help
Entry
AaeL_AAEL013253   CDS       T01053                                 

Gene name
AAEL801174
Definition
(RefSeq) AAEL013253-PA
  KO
K08601  
ubiquitin thioesterase [EC:3.4.19.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AaeL_AAEL013253 (AAEL801174)
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AaeL_AAEL013253 (AAEL801174)
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C67
   AaeL_AAEL013253 (AAEL801174)
Ubiquitin system [BR:aag04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AaeL_AAEL013253 (AAEL801174)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 642 aa AA seqDB search
MVPDYVDQTMLDSIPLTVLEHFDWGDDSEQNDYEEIMEPPIQWIIMVFTDYIYQRLSRFF
AYVFSRSIAPPRANDVLDYSSSEEPNDASLPPAYDNSNNVPHTITSSPSEGSTTAEIVIQ
PSPLRELPDNPLLEVGSMVEVDVEKAELYGVIRWIGPLHSFGTDSSNTRVMVGIELEDEP
IEPSIHGTDGTYNGVKLFKCPANRAIFVYPAQCNQDRRFQDVVATSPSAPRIVASTSKSS
DANNMFGKVDCPIVEGAVAPLKILQQKELESICGQFRGIQGHHNSCYLDATLFSMFTFTS
VFDSLLFRPREPEDNPQYEEVQRVLREEIVNPLRKNHFVRADRVMKLRHLLDRLSSVTGL
TSEEKDPEEFLNSLLAQILRADPFLKLSSGLDTFYYQLFVEKDDQLKLPSVQQLFEQSFL
TSNIKLKEVPSCLIIQMPRFGKNFKMYPRILPSQVLDVTDIIEDSPRQCTVCGKLAEHEC
RECLGGITLVGVSLESTAFCKACFDTAHSHVKRQNHTPSPLTVPKDFKMMAEHCAVPRLF
MELFAVVCIETSHYVAFVKAGAGQDAPWVFFDSMADRRGEQNGYNIPEMIPVPDLPQWLS
DEGARQLNEKAINDKMLPEHAKRLLCDAYMCMYQSTDVMMYR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggttccagactacgtcgatcaaactatgctagacagcatcccacttaccgtgttagaa
cactttgattggggtgatgactctgagcaaaacgattatgaagaaataatggagcctccg
attcagtggataatcatggtctttacggactatatctatcagcgcttatcgagatttttt
gcttacgtattctctcgttctattgctccgccgcgtgccaacgatgtcctggattattcg
tcttccgaagaaccgaacgatgcatcattgccgccagcctacgacaatagtaacaacgta
cctcacacgatcacttcgtccccatcggagggatcgacgacggcggagattgtgattcaa
ccgtcgccgttgagggaacttccggacaatccgctgctcgaagtcggctccatggtggag
gtcgatgtggaaaaggctgagctgtacggggtgatccgttggatcggcccattgcacagc
ttcgggacggacagcagcaatacacgggttatggttggcatagaactggaggatgaacca
atcgaaccgagcatccatggtacggacggaacgtacaacggagtcaaactcttcaaatgt
cccgcaaatcgggccattttcgtctatcccgcacaatgcaatcaggatcgtcgtttccag
gacgtagtcgctacatctccatccgcgcccaggattgtagcgtcgacgtccaagtcgtcg
gatgctaacaacatgttcggcaaggttgactgccctatcgtggagggtgccgttgcaccg
ttgaaaattttacaacagaaggaattggaatcgatctgtggccagttcagaggaatccag
ggccaccataactcgtgttatttggatgctactttgttttcaatgttcacttttacgagc
gtgtttgactcgctactattccggcccagggaacccgaggataacccacaatacgaagaa
gttcaaagggtattacgtgaggagatagtcaatccactgcgtaagaaccattttgtccga
gccgatagggtgatgaagttgcgtcatttgctggaccgacttagctcggtcactggactc
accagcgaagagaaggatccggaggagttcctcaacagtctgctggctcagattttacga
gcggaccctttcctgaagttaagttccggactggacacgttttactatcagttgttcgtt
gagaaagacgatcagctaaagttaccatccgtgcagcagctattcgagcagagtttcctg
acatccaacattaagctgaaggaagtgccatcgtgtctcataatacagatgccacgtttc
ggcaagaatttcaaaatgtatcctcgaatattaccatcgcaggtattggacgtgacggat
atcattgaagattctccacgacaatgtaccgtgtgcggtaaactggcggaacacgagtgc
cgggagtgtctcggaggaataacgctggtgggagtgagcttggaaagtacggctttctgt
aaggcatgtttcgatacggcacattcccatgtaaaacgccagaaccataccccaagcccg
ctgactgtgccgaaagatttcaaaatgatggcggaacactgtgcggtgcctcggttgttc
atggagctgtttgccgtggtttgtatcgaaacgtcgcactatgtggcgtttgtgaaggcc
ggtgccggacaggatgcgccgtgggtgtttttcgattcgatggcggaccggcgcggtgag
caaaatggctacaacattccggagatgatcccggtacccgatctgccgcagtggctctcg
gacgaaggcgcccggcagctgaacgagaaggccatcaacgacaagatgttacctgaacat
gccaagcgactactctgtgatgcctacatgtgcatgtaccaaagcacagacgtcatgatg
tatagataa

DBGET integrated database retrieval system