KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013286Help
Entry
AaeL_AAEL013286   CDS       T01053                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    AaeL_AAEL013286
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     AaeL_AAEL013286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 313 aa AA seqDB search
LRKKLKLTDPPDQEFGLNVVQPSEFSLNTFINEPRPKLQLAPVTLTSPHFAGNPQNQHLP
PVQPEQSPPLWRRVYQLELELCEALLQIPLPSDVAATYNPIEYAAELHLAYMQRFLTGHK
PVLFLGMNPGPWGMCQTGVPFGYVPAVRDWMQLRGQVLKPIGELAVRPVTGLECTRGEQS
GQRWWGLYQELCGAPENFFRNCFVFNICPLAFFHASGKNITPAELKGTAKTRMQDVCSEY
LLRALHLFGPTVIVSIGRYCEDRVKLLVRQNLLDASRVRLLCIPHPSPRSLNNTNWAEKA
RQWLVDHGVMPYL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaaaaagctcaaactgaccgatccgccagatcaggaattcggcctcaacgtcgtc
cagccgtccgaattttcattgaacaccttcatcaacgaaccgaggcccaaattgcaattg
gcaccagtcactcttacctcgccccatttcgccggcaatcctcaaaatcagcaccttccc
cccgtccaaccggaacaatcgcctccgctttggcgtcgcgtgtaccagctggagctcgag
ctgtgcgaagctttgctgcagattccgctgccctcggacgtggcggccacttacaatccc
attgaatacgcggccgaactgcacttggcctacatgcagcgctttctcacgggccacaaa
ccggtgctctttctcggcatgaaccccggaccgtgggggatgtgccaaaccggggtgcct
tttggatacgttccggcggttcgcgattggatgcaattgagaggccaagtgctgaaaccg
attggggaattggccgtacgaccggtgaccggactagagtgtacccgtggcgagcagagt
ggccaacgctggtggggactgtatcaggagctgtgcggggcaccggagaatttcttccga
aattgtttcgtgttcaacatttgcccgctggcgtttttccacgcgagtggcaagaatatt
acaccggcggagttgaagggcactgccaaaacccgcatgcaggacgtctgttccgagtac
ctgttgcgagcgctgcacctgttcgggcccacggtgatcgtgtccatcggtcggtactgc
gaagaccgagtcaaactgctggtccggcagaatctactggacgcgagtcgagttcgcctg
ttgtgcattccccaccctagcccacgcagcctgaacaacaccaactgggcggagaaggct
cgccagtggcttgtggatcacggggtcatgccgtatctg

DBGET integrated database retrieval system