KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013353Help
Entry
AaeL_AAEL013353   CDS       T01053                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Exosome [BR:aag04147]
 Exosomal proteins
  Proteins found in most exosomes
   AaeL_AAEL013353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVSKAAIAGHDGGIWAKSDGFEVSKEELAKIVQGFDKTELLTSGG
VTLAGQRYIYLSGTDRVIRAKLGKMGVHCMKTQQAVIVSIYEEPVQPQQAASIVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattatgttgacaatcagctcctggcttcccagtgcgtttcgaaagcg
gccattgccggtcatgacggcggcatttgggccaaatccgatggattcgaagtatcaaaa
gaagaactggcgaaaatagtgcagggctttgacaaaaccgaactgctcacctcaggaggc
gtgacactggccggccagcgttacatctacctctccggaaccgaccgagtaatccgagct
aagctgggcaagatgggagtacattgtatgaagacacagcaggctgttatagtatcaatt
tacgaagagccagtgcagcctcagcaagcagcgtctatagtcgaaaagcttggagattat
ctaattacctgtggttattag

DBGET integrated database retrieval system