KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013614Help
Entry
AaeL_AAEL013614   CDS       T01053                                 

Definition
(RefSeq) AAEL013614-PA
  KO
K04646  
clathrin heavy chain
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:aag00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AaeL_AAEL013614
   04142 Lysosome
    AaeL_AAEL013614
Exosome [BR:aag04147]
 Exosomal proteins
  Proteins found in most exosomes
   AaeL_AAEL013614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1677 aa AA seqDB search
MSQALPIRFQEHLQLTNININPSSISFTNLTMESDKFICVREKIGETAQVVIIDMNDAQN
PIRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHAMTEEVVFWKWITLNTLS
LVTETSVYHWSMEGDSTPVKMFERHSSLNGCQIINYRTDPKQAWLLLVGISAQQNRVIGA
MQLYSVERKVSQAIEGHAASFATFKMEENKEPSTLFCFAVRSANAAKLHIIELVHPPTGN
TAFTKKAVDVFFPPEAQSDFPVAMQVSPKYDVIYLITKYGYIHMYDIETGTCIYMNRISA
DTIFVTAPHESSGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLSGA
EDLFVRKFNQLFQNGQYAEAAKVAAIAPRGILRTPQTIQKFQQVPAQPGTNSPPLLQYFG
ILLDQGKLNKYESLELCRPVLAQGRKQLCEKWLKEEKLECSEELGDLVKPSDPTLALSIY
LRSNVPNKVIQCFAETGQFQKIVLYAKKVNYSPDYIFLLRSVMRTNPEQGAGFASMLVAD
EEPLADINQIVDIFMEQNMVQQCTAFLLDALKNNRPSEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNGDWLVGFFGTLS
VEDSLECLKAMLTANIRQNLQICVQIATKYHEQLTTKALIDLFESFKSYEGLFYFLGSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNAERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCIEPATHNALAKIYIDSNNNPERFLKENQF
YDSRVVGRYCEKRDPHLACVAYERGHCDRELIAVCNENSLFKSEARYLVRRRDAELWADV
LSESNPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIVLDSSVFS
DHRNLQNLLILTAIKADRSRVMDYINRLDNYDAPDIANIAINNELYEEAFAIFKKFDVNT
SAIQVLIEQVHNLERANEFAERCNEPAVWSQLARAQLQQGLVKEAIDSYIKADDPSAYMD
VVETASKNESWEDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFVSGPNHADIQ
KIGDRCFNDKMYEAAKLLYNNVSNFARLAITLVHLKEFQGAVDGARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLITYYQDRGHFEELIGLLEAALGLERAHMGMFTE
LAILYSKYKPAKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKAIQFYLDYKPLLLNDMLLVLAPRMDHTRSVNFF
TKQGHLQLVKTYLRSVQSLNNKAINEALNGLLIDEEDYQGLRTSIDAFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDRLFKDAMEYAAESHQGELAEELLGWFLE
RGAHDCFAACLFQCYDLLRPDIILELAWRHNIMDFAMPYLIQVTREYTSKVDKLEVADAE
RQKEGENSEHKSIILPEPQLMLTAGPGMGMPQYAPQYAGGYVPAQPNMSPYPGYGGM
NT seq 6517 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaggctctcccgattcgtttccaggagcatttgcagctcaccaacatcaacatc
aatccgagctcaatctccttcaccaacctgactatggaatccgacaagtttatctgcgtc
cgagagaaaatcggcgaaacggcgcaagtcgtcattatcgatatgaacgatgcgcaaaat
cccattcgtcggccgataagcgctgattcagctattatgaatcctgctagcaaggtcatc
gctctcaaagctcaaaagactcttcaaatttttaacatcgagatgaaatcaaaaatgaag
gcccacgcaatgaccgaggaggtcgtcttctggaagtggatcacgctgaacaccttgtcc
ttggtgactgaaacttcggtttaccattggtccatggaaggagactcgaccccagtgaaa
atgttcgaacgacactcatcgctgaatggatgccaaatcatcaactatagaaccgatccc
aagcaggcttggcttcttctagttggtatttctgctcagcaaaaccgtgtgatcggggca
atgcaactatactcagtggaacgcaaagtgtcccaggcaatcgaaggtcacgcagcgtcg
ttcgcgacattcaagatggaagagaacaaggaaccatctacgttgttctgtttcgccgta
cgttcggccaatgctgccaaactgcatatcattgaagttggtgcaccccccaactggcaa
cactgctttcacgaagaaagccgtggatgtcttcttcccaccggaagcgcagagcgactt
cccagtagcgatgcaagtttcgccaaaatacgacgtcatttacttgatcaccaaatatgg
gtacattcatatgtacgacatcgaaacaggcacatgtatctatatgaaccgtatttcggc
ggatacaattttcgtaacggccccacacgaatccagtggaggcataattggtgtcaatcg
caaaggtcaagtactgtccgtaacagttgatgaggaacagatcattccatacatcaatac
ggttctgcaaaatcccgaccttgctctgcgtatggctgtccgcaacaatctttccggcgc
agaagatttgtttgttcgtaagttcaaccaactgttccaaaacggtcagtatgccgaagc
tgccaaggttgcagctattgctcccagaggaatccttcgtacccctcaaactatccaaaa
attccaacaagttcccgcccaacctggaactaactctcctcctttgttgcaatacttcgg
tatcctgctcgatcaaggcaagctgaacaaatatgaatctcttgaactgtgtcgccctgt
tttggcccagggtcgtaagcaactgtgcgagaagtggctgaaagaggagaaactggagtg
tagcgaagagctgggtgatctggtgaagccatcggatccaacattggccttgtccatcta
tctacgctcgaatgtcccgaataaggtcattcaatgcttcgcagagaccggccaattcca
gaagatagttctttatgcaaagaaagttaactacagcccggattatatcttcttgttacg
ctccgttatgcgtaccaatccggaacaaggcgctggattcgcaagtatgttggttgccga
cgaagaacctctggccgacattaatcagatcgtagacatcttcatggagcaaaacatggt
tcagcagtgtaccgctttcctcttggatgctttgaaaaacaatcgtcccagcgaaggagc
acttcaaacccgtctgttggaaatgaatttgatgtcggctcctcaggtggcagatgctat
tcttggtaacgctatgttcactcattacgatcgagcccacatcgcccagctatgcgagaa
ggccggattgttgcagcgtgctttggagcattatacggatttgtatgacattaagcgtgc
tgttgtccatacgcatctgttgaacggagattggctggttggattcttcggtacattgtc
ggttgaggattcgttggaatgtttgaaggcaatgctaactgccaacattcgccagaattt
gcaaatctgtgtacaaattgcgaccaaatatcatgaacagctaactacaaaggcgttgat
tgacttgtttgagagcttcaagagctacgaaggattgttctacttccttggatcaattgt
caacttcagccaggatccggaagtgcacttcaagtatattcaagcagcatgcaagacgaa
ccaaattaaggaagtcgaacgtatttgccgcgagtccaattgctacaacgccgaacgtgt
taagaacttcctcaaggaagctaagttgaccgatcaactcccgttgatcatcgtttgcga
ccgtttcgattttgtccacgaccttgtactgtatctgtaccgcaacagtctgcagaaata
tattgaaatttatgtgcaaaaggtgaatccatctcgactcccggtcgtcgtcggaggact
gctggatgtcgactgttctgaggacatcatcaagaacctgatcctggtagtgaaaggtca
attctcaacagacgagcttgtagaagaagttgaaaagcgcaatcgtctcaagttgttgct
tccgtggctggaatcccgtgtccacgagggttgtattgaaccggcaactcataatgccct
ggctaaaatctacatcgattcgaataataatccggaaaggtttttgaaggagaaccaatt
ctacgacagccgtgtggtgggaagatactgcgaaaaacgcgatcctcatttggcttgcgt
tgcctacgaacgtggacattgtgaccgagagctgattgctgtgtgtaatgaaaactcgct
cttcaaatccgaagccagatatctggttcgtcggcgtgatgcagaactgtgggccgatgt
gctatcggaatcgaacccgtacaaacgtcaactaatcgatcaagtggtgcagactgctct
ttccgaaacacaggatccggatgacatctccgttactgtgaaagccttcatgaccgctga
tttgccgaacgagttgattgaattgctggaaaaaattgtgttggattcttcggtgttctc
ggatcatcgcaatctacaaaatctgctcattctcacggcaatcaaagctgacagaagccg
agtcatggattacattaaccgtttggacaattacgatgcacctgatattgccaacattgc
tatcaacaacgaactgtacgaggaagcgttcgcaattttcaagaaattcgatgtcaatac
ttctgctattcaggttttgatcgagcaggtgcacaatttggagagagcaaatgaattcgc
cgaacgctgcaatgaaccggcagtttggtcccaattggcgcgagcacaattacaacaagg
cttggttaaggaagccatcgacagttacatcaaggccgatgatcctagcgcatatatgga
cgttgtagaaactgctagcaagaatgaatcgtgggaagatttggtacgctatctgcagat
ggcacgcaagaaggctcgtgaaagctatatcgaaagcgaattgatttatgcctacgctcg
gactggtcgtctggcagatttggaagaattcgtctccggaccgaatcatgctgatatcca
gaagatcggtgatcgttgtttcaatgataaaatgtacgaagccgccaaattgctctacaa
caatgtcagcaatttcgccaggttggctatcactttggtgcatttgaaagagttccaagg
agcggtggatggcgcgagaaaagccaattcgactcgtacgtggaaggaggtttgcttcgc
ttgtgttgatgccgaggaattccgattggctcagatgtgcggattgcacattgtggttca
tgcggacgagctggaagatttgatcacttactatcaagatcgaggtcatttcgaagagtt
gattggactccttgaagcagcactcggtctggagcgcgcccatatgggcatgtttaccga
gttggccatcctctactcgaaatacaaaccagctaaaatgcgtgaacacttggagctatt
ctggtcacgtgttaacattcctaaagtacttcgcgccgcagaacaagctcatctctggtc
ggaattggtgttcttgtacgacaaatacgaggagtacgacaatgctgtactggcgatgat
ggctcaccctactgaagcatggagggaaggacacttcaaagacattattacaaaggtggc
caacattgagctctactacaaggccattcagttctatctcgattacaagccgcttctgct
gaacgatatgctcctcgtgctggcacctcgcatggaccatactcgttcggtaaacttctt
cacaaagcaaggacatctacagttggttaagacataccttcgttccgtgcaaagcttaaa
caacaaggcaatcaatgaagcactaaatggactcttaattgacgaagaggactatcaggg
cctcagaacttcgatcgacgcgttcgacaactttgacaacatcgctcttgctcagaaact
ggagaaacacgaactaacggaattcagacgaattgctgcttacttgtacaaaggaaacaa
tcgctggaagcagagtgtggaattgtgcaaaaaggaccgtctcttcaaagacgccatgga
atatgcggccgagtcacatcaaggtgaattggcagaagagttgcttggttggttcctaga
acgtggcgcgcacgattgtttcgcggcatgtttattccagtgctacgacctcctgcgccc
agatatcatcttggagctggcatggcgtcacaatattatggactttgcgatgccctattt
aatacaggtgacacgagaatacacatccaaggttgataagctggaagtggccgatgctga
acggcaaaaggaaggagagaactccgaacacaaatcaatcattctgcccgaaccccaact
catgttaaccgctggtccgggaatgggaatgccacaatacgccccgcaatatgccggagg
ttacgtgccggcgcaaccaaatatgtcaccatatccgggatatggtggtatgtaaaaaca
caacccacacacacgttcgaacatgcatcgtagttctgaaatcgtagtttgactgtgcta
tcgatagacactaaaatcatttattttttgtcttcttaattacgactcgctcgctaacgt
gcagcgttcagctaaggtgaacattactgatcatttcgttttcaactagttgtacaagag
aggttatatatattatcgcaaacatgaatatagaaaatcagaaattaagatataacaact
aaactataaaccgaagagttcggatgctatatttattaatatgttgatatattttttcaa
ttaaatctaaattgtgttagtcactttcaacgagactaaaattaaacaataaagataatg
cccatctcaaaagcgatcttactctatccatctactacagccgtggtacgcaaatttagc
catgtatttacatcacacaaattgaataaatgaaaaatcagtctattattttaaacaatc
aattacaaattgtcagaaaagtgaaatactactcccaaagaaaacgtggataccatatgt
agttcaagtgtacttttcatcagggcatctgttatttgttgaatatatgtgtggtttaaa
gatgtggttacttattttggtaccattggctgtgtctatttagcaaacatcgttgataaa
ttaataagcagtgatgaagttaaaactatcttcggaagatttgttttgcaacaagcgtcg
ttagattcaaatctacaaaaatattgtaaatatattcaaaaatggaaaaaggcttatata
attcacaaattatataaaatatataaaaccgaattgtaggtatctccggtggtgcaaatc
gttaaaaaatgataaaacattagttctccgatgcagtagatataaacacttgaagagttt
tattttaccaaattgatttctaaagtacatttttttgagaaaaaattaagaagaaataga
tttatacataaacaaaatcagtatttttttcctaaattaggtcactttcatttcaattga
cccaatgtatcacattcaacgttgtttgctagtcacctttgctttccttcgacaattcgt
tactatgaacttttcaatggttttatgtctgtgttttacaaacaatcataaatttgcatt
cctttctaaaataaattatacgagagttaaaacgtcgttatgaggcatgatgaaagaggt
gacttgccagtttcgctgtattgtctgacttttcagtagttatgttatcgaagtcatgta
tcataaatcatacgcgagatacaaattcatagaacaactcaacaaaaatatgtatcaagc
caactaatgctgtaatatggccgaactagctgtcataatcgcatacgtgcaattcgtatg
gtcccgttatgcgattatgggaagcttatcacacagagtcgtatagtactatacttagta
gaaaatatattgatatatgcttaaatcaacttactgt

DBGET integrated database retrieval system