KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013732Help
Entry
AaeL_AAEL013732   CDS       T01053                                 

Definition
mannosyltransferase 1, putative
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AaeL_AAEL013732
Enzymes [BR:aag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     AaeL_AAEL013732
Glycosyltransferases [BR:aag01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   AaeL_AAEL013732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 685 aa AA seqDB search
SWWIVFGAILALTLGTRFYNVTVPDHVCWDETHFGKMGSWYINRTFFFDVHPPLGKMLIG
LSGYLTGYDGKYPFDKPGDKYNGTHYEGMRIFCTAMGAAIVPMSFHTVWDMTGSLTASAF
GAAYILFDIGMLILNRYILLDPPLIFFMTASVMGMARVTKLTRNQESFTRSWWTWLCFTG
AMLACTISVKFVGLFVVMLVGLHTASDLWDVLGDLTKPISYTVKQLVARAVTLIILPIIL
YATFFYIHLNVLNHSGSGDGFYSSGFQSNLVGNSLYNVSMPREVAYGAVVTLKNHKTGGG
YLHSHNHLYPKGFGAKQQQVTTYSHKDENNKWLIKPYNKQTVDNVTLVKHGDLIRFEHIQ
TKRNLHSHREQAPVTKKHMQVTCYGEEGQGDSNDVWQVQIIGGKDGDIVETVTSRLIFYH
YIERCVLTTTAKQLPKWGFEQQEVTCNPNIRDRSAVWNVEDNQFDKLPSVNFQVYAPGFI
SRFFESHAVMLQGNSGLKPKEGEVTSRPWQWPINYRGQFFSGSDHRVYLLGNPIIWWSNL
VFLGLFIIVFLVEVIKYQRNLGSQQSGQTNSTVEEFKWRSLRASAWLFGGWLLHYLPFYA
MGRVLYFHHYFPALVFNSMLAGVMLDYLTVKLPSWLRHTILGVALAALVYSFALFSPLAY
GMNGPFSHEPNSTLSGLKWMDTWEF
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
agctggtggatcgtgtttggagcgatactggcgctaacactgggaacacgattctacaat
gtgacggtgccggatcatgtttgctgggacgaaacccatttcggtaaaatgggcagctgg
tacattaatcggacgtttttcttcgacgttcatccaccgctgggcaaaatgttgatcgga
ttgtctggatacctgaccgggtatgacgggaagtatccgttcgataagccgggtgacaag
tacaatgggacgcactacgagggcatgagaatcttctgtaccgctatgggtgcggccatc
gttccgatgtccttccataccgtttgggacatgactggatcgctgacggcgtctgctttc
ggtgccgcttacatcctgttcgacatcggcatgctcatcttgaaccgatacatactgctg
gatcctcctttgatatttttcatgaccgcatccgtaatgggcatggcacgtgtcacaaaa
ctcacccggaaccaagagagcttcacacggagttggtggacctggttgtgcttcacggga
gcaatgctagcctgtaccatcagtgtaaagtttgtggggctgttcgttgtgatgttagtt
ggactccataccgctagtgatctgtgggatgttctcggagatttgaccaaaccgatctcc
tacactgtaaagcaattggtagctcgagccgttacgcttataattttgccgattatcctg
tatgcgacatttttctatattcatctaaacgtgttgaaccacagtggaagtggagacgga
ttctatagttctggcttccaatcaaacctggttggaaattcactgtataacgtctcaatg
cccagagaagtagcttacggagcagttgttacgttgaaaaatcataaaactggaggtggc
tatctacactcgcacaaccacctttatccaaagggtttcggcgccaaacagcaacaggtg
acgacctacagtcacaaggacgaaaacaacaagtggttgataaagccctacaacaagcaa
acggtggataatgtaaccctggtaaagcacggagatttgattcgattcgaacatatccaa
accaaacggaacttgcactcgcatcgggaacaagctcctgttacgaaaaagcacatgcaa
gtcacgtgctacggagaggagggacaaggtgatagtaatgatgtctggcaggtgcagata
attggcggcaaggatggtgatatagttgaaaccgtgacgagtcgtttgatattctaccac
tacattgaacggtgcgttctgacgacaacggctaagcagttgccgaaatggggattcgaa
cagcaggaagtaacttgcaatccaaacatccgggataggagtgccgtttggaatgtggaa
gataatcaatttgataaattacccagcgtcaacttccaagtctatgcaccaggattcatc
agtcgtttcttcgaatcacatgcagtgatgcttcagggaaattccggtttgaaaccaaag
gaaggtgaagtaaccagccgaccatggcaatggcccattaattatcggggccagttcttc
tccggatcggatcatcgcgtttatttgctgggtaatcctataatttggtggagcaattta
gtatttttaggactgtttattatcgtcttcttggttgaggtcataaaataccaaagaaat
ctaggatctcaacaaagtggacaaacaaatagtactgtagaagaattcaaatggcgttca
ctgagggcatcggcatggcttttcggaggatggctactgcattacttgccgttctatgca
atgggacgagttctctacttccatcactacttcccggctctggtattcaactcaatgcta
gcaggtgtgatgctggactacctcacggtgaagctcccaagttggctgcgccatacgatt
ctgggggtggcattggctgctctagtttatagctttgcactgttctcacccttggcgtac
ggaatgaatggaccgttttcgcacgaacccaactcaacgctgtccgggctcaagtggatg
gatacgtgggagttttga

DBGET integrated database retrieval system