KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL013939Help
Entry
AaeL_AAEL013939   CDS       T01053                                 

Definition
erk1/2
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:aag04013]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:aag04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aag04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aag04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:aag04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 333 aa AA seqDB search
MLWVDLGMRSAVDTVTKTKVAIKKISPFEHQTYCQRTLREIKILTRFKHENIIDIRDILR
VPSIEQMKDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLK
PSNLLLNTTCDLKICDFGLARVADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDI
WSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQEDLECIINEKARSYLQSLPYKP
KVPWSRLFPNADSNALDLLGKMLTFNPHNRISVEEALAHPYLEQYYDPADEPVAEEPFRI
AMELDDLPKETLKRLIFEETLRFNHNDNHPDVM
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctttgggtggatttgggtatgagatctgccgtggacactgtgacaaagacaaaggtt
gccatcaaaaaaatatcccccttcgagcaccagacctactgtcagagaacgttacgggaa
atcaaaatcctcacccggttcaaacacgagaacatcatagacataagagatatcctgcgg
gtgcctagtatagaacagatgaaagatgtatatattgttcagtgtttaatggagactgat
ctatacaaactgctgaaaacacagagacttagtaacgatcatatctgctatttcctgtac
caaattctgcgcggtctcaaatacatccactcggcgaacgtgctccaccgggatctgaaa
ccgagcaacctgctgctgaatacgacttgtgatttaaagatttgtgatttcggtctcgca
cgagtggctgacccggaacatgaccacaccggcttcctgacggagtacgttgccactaga
tggtaccgagcgccggaaatcatgctcaattccaagggttacaccaaatcgatcgacatc
tggtcggtgggctgcatactggcggagatgctcagcaaccggcccatcttccccggcaag
cactacctggaccagctgaaccacatcctgggcgtgctgggttcgccctcccaggaggac
ctcgagtgcatcatcaacgagaaggcccgcagctacctgcagtcgttgccgtacaaaccg
aaggtcccgtggtcccggttgttccccaatgccgactcgaatgcgctggacctgctcggc
aagatgctcaccttcaacccgcataaccgaatttcggtcgaggaagccctggcgcatccg
tacctcgagcagtactacgatcccgccgatgagcccgtggccgaggaaccgttccgcatc
gccatggaactggacgacctacccaaggagacactgaagcgattaatcttcgaggaaacg
ctacgattcaaccacaacgataaccacccggatgtaatgtaa

DBGET integrated database retrieval system