KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014012Help
Entry
AaeL_AAEL014012   CDS       T01053                                 

Definition
membrane-associated guanylate kinase (maguk)
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    AaeL_AAEL014012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 770 aa AA seqDB search
MHSMWCDLFDLNKKLNGSVKPIPPPRDHLRIEKDGRLTNRAPVPAPQVPDRKLLPTTPQH
IGQVVEPTPDQLNSIKKFEEQLRRRREEEERIAAQNDFLRNSIRGSQKLRHLQDNPVVEK
STIGVDNEAYTEDEEPEKIIGYGELVSALQRLQGHLNKHGLAALAGRVTAAQSLLLGPGI
ARALAARTAVLERRRPRIQNPICSNAQALAKDCVESLAQSSTPAAIELCDLLSTYEMEGL
LLAHDRIASTTDRSPAYGVSAVSQNPAVPLPLNNNTMTSATPVKPTSVLPSIPNNTSLVN
NNNNNIAKREPMSVPLGVLRDGSQDHIRIIQIEKSSEPLGATIRNEGEAVVIGRVVRGGA
AEKSGLLHEGDELLEVNGIEMRGKSINDVCTLLSAMTGTLTFLVVPASRPPLDPTIRGGT
RTGSCAVLHVRAHFDYDPEDDRYIPCRELGISFQKGDVLHVISRDDPNWWQAYREGEEDQ
TLAGLIPSQSFQHLCESMKLANAGEVGLRARRDANGKAGGFTLLCARKGQKKKKKASSEH
GYPLYATATAEDPEPEEILTYEEVALYYPRASHKRPIVLIGPPNIGRHELRQRLMADSER
FAAAIPHTSRPQREGEIPGQDYHFISRQQFEADILARKFVEHGEYEKAYYGTSLEAIRAV
VASGKICVLNLHPQSLKLLRSSDLKPYTVLVAPPSLEKLRQKRIRAGEPYKEEELKEIIA
TARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPSSWLHN
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgcatagcatgtggtgtgatttgttcgatctgaacaagaagctgaatggttcagtgaaa
ccgatcccaccgccccgcgatcatctgcgaatagagaaggatggtcgccttacgaatcgg
gctccggttccagcgccacaagtgccagaccggaagctgttgccaacgactccccagcac
attggacaggtcgtggaaccgacgcccgatcaactgaatagcatcaaaaaattcgaggaa
caactacgccgccgacgggaggaggaagaacgaatagcagctcagaatgactttttgcgg
aatagcatcaggggctcgcaaaaattacgacacctgcaggacaacccggtcgttgaaaaa
tccaccataggtgttgacaatgaggcctatacggaagacgaagaacccgaaaaaatcatt
gggtatggtgagctagtatcggccttgcagcgattacagggacacctcaacaagcatggc
ttggccgcactcgctggtagagtaacagcggcccaaagccttttgttgggtccaggtatt
gcacgtgccctcgctgctcgcactgctgttctagagaggaggcgaccacgaatacaaaac
cccatttgctcaaatgctcaggcactggctaaggactgcgtcgaatccctggcccagtca
agtacaccagctgcaatagaactatgtgatctgctctcgacttatgaaatggaaggactg
ttgctggcgcacgatcggattgcttcaacgaccgatcgctcgccggcatacggagttagt
gcagtcagtcagaatcccgcggtgccattgccattgaacaataatacgatgaccagcgct
actccggtcaaaccgacatcagttttgccatctattccaaataatactagcttagttaat
aacaataacaataatatagcaaagcgtgaacctatgagtgttcctctcggtgttctacgg
gacggtagtcaggatcatataagaatcatacagattgaaaaatcttcggaaccgttggga
gcgaccatccgaaacgaaggagaggctgtagtgattggtcgagtggtacgaggaggagcg
gcggagaagtccggcctgttgcacgagggcgatgaattgctcgaagtgaacggtatcgaa
atgcgtgggaaatccataaatgacgtttgcactctgctcagtgcaatgaccggtactctc
acgttccttgttgtgcccgccagtaggcctccattggatccaactatacgcggtgggaca
cgtaccgggtcctgtgcggtactgcacgttagagcacactttgattacgatccggaagat
gatcgatacattccgtgccgtgagcttggcatcagttttcagaaaggagatgtattgcat
gtgatatctcgtgatgaccctaactggtggcaagcgtatcgagaaggcgaagaagatcaa
acattggccggacttatacccagccaatcattccaacatttgtgcgagtccatgaagttg
gccaatgctggtgaagttggtttaagagcacgcagggatgccaacggtaaagcgggtgga
ttcactctgctttgcgccaggaagggacagaagaagaaaaagaaagctagtagtgaacat
ggctaccctctgtacgctacagctacagctgaagaccctgaaccggaggaaatcctaaca
tacgaggaagtcgccctttactatccacgtgcgtctcacaaacggccgatagtgctgatt
ggaccaccgaacattggccgacacgaacttcgacaacgattgatggccgattcggaaaga
ttcgctgctgccattcctcatacgtctcgtcctcaacgcgagggagaaattcctggacaa
gattatcacttcatttcgagacaacagttcgaagcagatatactcgctaggaaattcgtc
gaacacggagaatacgagaaggcttattacggcacatctttggaagcgatccgcgcagtt
gtggccagcggaaagatatgcgtcctgaacctacacccccagagcctaaaacttctacgt
tcttcggatctgaagccctacacagtattggtggcaccaccaagtttagaaaagcttcgt
cagaagcggatacgagccggtgaaccgtataaggaagaggaactgaaggagatcattgcc
actgcgcgcgacatggaagcacgatggggccacctgttcgacatgatcatcatcaacaat
gacacggaacgagcctatcatcagcttctcgccgaaataaactcactcgaacgagaacca
caatgggtgccaagtagctggctgcataactaa

DBGET integrated database retrieval system