KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014072Help
Entry
AaeL_AAEL014072   CDS       T01053                                 

Definition
tip60
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AaeL_AAEL014072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 342 aa AA seqDB search
LTEGCRLPVRMTGTNDWPLAEIISIKEATDKSVWYYVHYVDFNKRLDEWVPEEYLDTRKV
QFPRKDGLATGQNTGVTTPKRIPIGERSRPASPVLPPDILNGGARKATSTENEDSQDVPS
TPTPRQSGSMVMHHDDVVTRMKNVQLIELGQHRIKPWYFAPYPQEMCSMSCIYICEFCLK
YRKSRKCLERHIKKCNLRHPPGNEIYRKHTISFFEIDGRKNKSYAQNLCLLAKLFLDHKT
LYYDTDPFLFYVMTEFDSRGFHLVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEF
SYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEILILAK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
cttacggaaggatgtcggctaccggtgcgaatgaccggcacgaatgattggccgctggcg
gaaatcatcagcatcaaggaagccacggataaatcggtttggtactacgtgcactatgta
gattttaacaaacgtttggacgaatgggtaccggaagagtatttggatacgaggaaagtt
cagttcccccggaaagatggtttagcaactggtcagaacacaggagtaacgacaccgaag
cggataccaatcggagagcggtcacgtcctgccagtcccgtgttgccaccggatattctg
aatgggggagcacgaaaagccacctccacagagaacgaagactcacaggatgttccgtcg
acgccaacgccgcgacagtccggaagtatggtcatgcaccatgacgatgtcgtgacccgc
atgaagaatgtccagctgatagaactcggtcagcacaggatcaaaccgtggtacttcgcg
ccctaccctcaagaaatgtgttccatgtcctgcatctacatctgcgagttttgtctgaag
taccgaaagagtcggaagtgcctggagaggcacatcaagaagtgcaatctgaggcatccg
ccgggcaacgaaatctaccggaagcacacgataagcttcttcgagatcgacggccgcaag
aacaagagctacgcgcagaacctgtgcctgctggccaagttgttcctcgaccacaaaacg
ctctattacgacacggatccgtttctgttctacgtgatgaccgagttcgactcgcgggga
ttccacctggtggggtatttttccaaggagaaggaaagcaccgaggactacaacgtggcc
tgtatactgacgatgccgccgtaccagcggaagggctacggcaagctgctcatcgaattt
agttacgagctgtccaagtttgagggcaaaactggctccccggagaagccgctgtcggat
ttgggtttgctgtcctaccgaagctactgggcgcagacgatactggaaatactgattctg
gcgaaa

DBGET integrated database retrieval system