KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014244Help
Entry
AaeL_AAEL014244   CDS       T01053                                 

Definition
glucosyl/glucuronosyl transferases
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AaeL_AAEL014244
   00053 Ascorbate and aldarate metabolism
    AaeL_AAEL014244
   00500 Starch and sucrose metabolism
    AaeL_AAEL014244
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    AaeL_AAEL014244
   00860 Porphyrin and chlorophyll metabolism
    AaeL_AAEL014244
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    AaeL_AAEL014244
   00982 Drug metabolism - cytochrome P450
    AaeL_AAEL014244
   00983 Drug metabolism - other enzymes
    AaeL_AAEL014244
Enzymes [BR:aag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     AaeL_AAEL014244
Glycosyltransferases [BR:aag01003]
 Others
  Hydrophobic molecule
   AaeL_AAEL014244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 524 aa AA seqDB search
MCSWVSIRLLKLIPVLLLSTLAWHQTDSSRILGVFVFPSRSHWMMIDSILNGLLDRGHQV
TVIANHPLSRKHENYTDLRVSPIYDFWKKSVKVDSLYDLTEISIHQMLMNFLYSLGLETA
QHGFTRDNIREFIRSDDSHFDLILAEQFYQEAYLMLAHKYKAPIVTVGTFGFAHYMGPLM
GMMNMYSHVPHEFLPFMDKMSFPQRIYNTGVSLYEQFLRTIYYLPRQEAMAKENFGHLPG
PLPKVADLERKVSVVLLNSYYPLTTARARVPGMIQVGGLHIKNPKPLPEDLQKFLDGADH
GAIYFSLGTNLKSSDMPQDKLDAILNVFRSMKQRIVWKYEDESIKGLPSNVLIKSWMPQN
DILAHRNVKVFITHGGLLGTQEGVHRAVPMLGIPIYADQHLNMNKAVLGGYAVRLQFPNI
TETSFRWALDELLYKPEYKENMNRVSAVFRDRPVPALEEAIYWIEYVIRHKGAPQLRSAG
LDLPWVSFASLDIAALVLGVLLLCAWIVRKLLRIIVSDKKRKTD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagttgggtttctattcgtttgctgaaactcatccccgttctgctattaagcacc
ctggcatggcaccagacggactcttcccgtattctgggagtgttcgtgtttcccagccgc
agccactggatgatgattgactccatcttgaacggactactggaccgaggccatcaggtc
acggtaatcgcgaaccatcctttgtccaggaagcatgagaactacaccgatctacgggtg
tcacctatctacgacttctggaagaaatcggtcaaggtggactccctgtacgacctgacg
gagatttccatccaccagatgttgatgaatttcctgtacagtttgggattggaaacggcg
cagcatggatttacgagggataatattcgggagtttattcggtccgatgacagccacttt
gatctgattctggccgaacagttctaccaggaggcgtacctgatgttagctcacaagtac
aaggctcccattgtgactgttggtacattcggattcgcacattacatgggtccgttgatg
ggtatgatgaatatgtactcccatgtccctcacgagttcctgccgttcatggataagatg
agcttcccacagcgaatttacaacacaggagtatcattgtatgaacaattcttaagaact
atctactatctgcccagacaggaagcaatggcaaaagagaactttggccatttgcctggt
cccctgccaaaagtggccgatctggagcgtaaggtttctgttgtgctgttgaacagctat
taccctttgacaacggcacgagctcgagttcccgggatgattcaggttggaggtctccac
atcaaaaaccccaagcctctgccggaggacttgcagaaatttttggacggagctgatcat
ggagcaatctattttagcttgggaacaaacttgaagagttcggatatgcctcaagataag
ttggatgccatcctgaatgtgttccgatcgatgaagcaacggattgtgtggaaatacgag
gacgaatcgataaagggtctcccgagtaacgtactgatcaagtcgtggatgccacagaat
gatatcctggcccatcggaacgtgaaagttttcattactcatggaggattgctaggcact
caggaaggtgtacaccgagcggttcccatgctgggcattccgatctatgccgatcagcat
ttgaatatgaataaggccgtgttgggcggttatgcggtccggttgcaattcccaaacatc
accgagacttcgttccggtgggctttggatgaactgttgtataaaccagagtacaaggaa
aatatgaacagggtttctgcagtgttccgggatcgcccggtgccagctctggaggaagcg
atctactggatagagtacgtgattcggcacaagggagcaccacagctgcggtccgctggc
ttggacttgccgtgggttagctttgcttcgttggatattgcggcactagtgctgggggtt
ttgttattgtgtgcgtggattgttcgaaagttgctgagaattatcgtaagcgataagaaa
cgaaagaccgactag

DBGET integrated database retrieval system