KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014246Help
Entry
AaeL_AAEL014246   CDS       T01053                                 

Definition
(RefSeq) AAEL014246-PA
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AaeL_AAEL014246
   00053 Ascorbate and aldarate metabolism
    AaeL_AAEL014246
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    AaeL_AAEL014246
   00860 Porphyrin and chlorophyll metabolism
    AaeL_AAEL014246
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    AaeL_AAEL014246
   00982 Drug metabolism - cytochrome P450
    AaeL_AAEL014246
   00983 Drug metabolism - other enzymes
    AaeL_AAEL014246
Enzymes [BR:aag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     AaeL_AAEL014246
Glycosyltransferases [BR:aag01003]
 Others
  Hydrophobic molecule
   AaeL_AAEL014246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 556 aa AA seqDB search
MQEILLCERNTSALSSAREIADGVSKTRARDQSNDMFKTILPLLLLSALSWHHAESSRIL
GVFVFPGRSHWMMIDAILNGLLDRGHQITAIANYPLSRKHENYTELRVAPIYDFWKNSVK
VESLYDLTDISIHRMLMDFLYNLGLETAQHGFTRENVRDFIRNDDSHFDLILAEQFYQEA
YLMFAHKYKAPIVSVGTFGFAHYMGPMMGMMNMFSHVPHEFLPFMDKMSFPQRIYNAAVS
LYEQTLRSFYYLPQQETMAQENFGHLPGPLPKVADLERQVSVVLLNSYYPLTTARARVPG
MVQVGGLHIKEPKALPEDLKKFLDGAKHGAIYFSLGTNLKSSDMPKDKLEAILNVFRSMK
QRVVWKYEDESVKGLPSNVLIKSWMPQSDILAHPNVKVFITHGGLLGTQEGVYRAVPMLG
IPIYADQHLNMNKAVLGGYAVRLYFPNITETSFRWALNELLYNPEYKKNMDRVSGVFRDR
PVPALDEAVYWTEYVIRHKGAPQLRSAGLDLPWVSFVMLDMVALVVGVVLVLGWVLRKLA
RAFICRNDGKRKRKAE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaattctcttgtgtgaacggaacacttcggccctaagcagcgcgcgcgagata
gctgatggtgtttcaaaaacgcgcgcacgcgatcaatctaacgacatgttcaaaacgatc
ctccccctccttcttctgagtgctctatcctggcaccatgccgaatcatcccgcatccta
ggtgtgttcgttttccctggccgcagccactggatgatgatcgatgccatcctgaatggt
ctgcttgatcgaggccatcagatcaccgccattgccaactatcccctgtcgagaaaacac
gagaactacactgaactgcgggtggcacccatctacgacttctggaagaattccgtcaag
gtggaatcactgtacgatctaacggatatatcgatccaccgaatgttgatggatttccta
tacaatttgggcctggagacggcgcagcatggatttactagagaaaatgttagggacttc
atacggaacgatgacagccatttcgatttgattttggccgaacagttctaccaggaggcg
tatctgatgtttgcccataagtacaaggctcccatcgtatctgtaggaacatttggtttc
gcacattacatgggccctatgatgggtatgatgaacatgttctcgcatgtccctcacgag
tttctgcccttcatggacaagatgagcttcccacagcgtatctacaatgcagcggtatca
ttgtatgagcagacgttacgatccttctactacttaccccagcaggaaacgatggcacag
gagaactttggacatctccctggtcctttgcccaaggtcgccgatcttgaacgacaagtt
tctgtggttctgttgaacagctactatccattgacgacggcgcgggctcgagttcccggg
atggttcaggtgggtggactccacattaaagaacctaaggctctgccggaggatttgaag
aagtttttggatggagcaaagcatggcgccatctacttcagcttgggtacaaacttgaag
agttcggatatgccaaaggataagctggaagccattctgaacgtattccgatcgatgaaa
cagcgtgtggtgtggaaatatgaggacgaatcggtgaaggggcttccgagtaacgtactg
atcaagtcgtggatgccacagagtgacattctagcgcatccaaatgtgaaggttttcatt
acccatggaggattgctgggaactcaggagggtgtttatcgagcggttcccatgctgggc
attccgatctatgccgatcagcatttgaacatgaataaggccgtgctgggtggttatgcc
gttcggttgtacttcccgaacatcaccgagacttcgttccggtgggcattgaatgagttg
ttgtacaacccggagtacaagaaaaacatggacagggtttccggagtattccgggatcgg
ccggtaccggccctggacgaagcggtatactggacggagtacgtgattcggcacaaggga
gctccgcagctgcgatcggcaggattggacttgccgtgggttagttttgtcatgttagat
atggtggctctggtggtgggggttgtattagttcttgggtgggtgttgaggaagttagca
cgtgctttcatatgccgcaatgatggaaagcgtaaaagaaaagccgaataa

DBGET integrated database retrieval system