KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014250Help
Entry
AaeL_AAEL014250   CDS       T01053                                 

Definition
insect replication protein a
Orthology
K10739  
replication factor A2
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AaeL_AAEL014250
   03420 Nucleotide excision repair
    AaeL_AAEL014250
   03430 Mismatch repair
    AaeL_AAEL014250
   03440 Homologous recombination
    AaeL_AAEL014250
   03460 Fanconi anemia pathway
    AaeL_AAEL014250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 247 aa AA seqDB search
MNDSFGAGGFSANATGGGAAQENKAEGVLPLTIRQILESSESGVQLFGIHYSMVTFVAIV
RSVDHSSTKITYGLEDHTGQVDAHLWLEEGDTNSVPGMMTHSYARVFGSVRHQGGSKAVM
IYKIEQVSSPNDVTTHLLEVLNARYKGEEYAKGGGAGGSGGESEKNTASSGGFMETDGNA
MGLTGKQLIVYKAIKSHMSDIGISRQELQQKFPHISASEMQSITDYMTQEGIVYTSVDSD
HFLCVDA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatagtttcggtgccggagggttcagtgccaatgccaccggtggtggggcagcc
caggagaacaaggccgagggcgttcttccgctgaccattcgacagatcttggaatcgtcc
gagagcggagtgcagttgttcggaatccactatagcatggtcacctttgtggccatcgtt
cggagtgtggatcattcgtcgacgaagattacctacggtctggaggatcacaccggccag
gtggatgctcacctgtggctggaggaaggcgacacaaacagcgtcccgggaatgatgacc
cacagctatgctcgggtgttcggatcggttcgccatcagggcggaagcaaggcggttatg
atctacaagattgaacaggtcagctccccgaatgatgtgaccacccatttgctggaggtg
ttgaatgctcgctacaagggagaggagtatgccaagggcggaggtgccggtggcagcggt
ggggaatcggaaaagaacaccgcctcgagcggaggattcatggaaacggatggcaatgcg
atgggactgacgggcaaacagctgatcgtgtacaaagctatcaagagccatatgtcggac
attgggattagtcggcaggagctgcagcagaagttcccgcatattagtgcctcggagatg
cagagcataacggattacatgacccaggagggaatcgtctacaccagtgtggactccgat
cacttcctatgtgtggacgcgtag

DBGET integrated database retrieval system