KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014321Help
Entry
AaeL_AAEL014321   CDS       T01053                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AaeL_AAEL014321
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AaeL_AAEL014321
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AaeL_AAEL014321
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AaeL_AAEL014321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 556 aa AA seqDB search
MPSASSTKTASTLNLIGALLRLALLSTIASVVIGSGYFDRVASLPCALRQYPTGSVCVCN
VTYCDTLEFEDPSRPGEFVLVSSSRNGTRFGQSRGKFVQADNATFLAAVRLLPRQRMTRS
TRSVIIEVNREKRYQRIVGFGGAFTGAVSYNLGLLKPELRKSMYRSYYSKKVGIGYNMMR
IPIGGCDFDLKPWAYNESPTDDAKLSNFTELDQRDVEKIEQIKELMEVTGNRDIKLMGAA
WSPPRWMKSNNDWSGSSRLKPEYYQTWADYHIQYLRLMKAAGLNYWAISTGNEPMNAVIG
FLFIRFMSLGWVATNQGKWVAKNLGPALKSSEFKNVKLFAGDDQRYTFPWWFSQMDQGHP
DATKFVDGFAVHWYWDGVTPPGLLDQASHLYPDKLIFNTEASLGDKPFQTHGPILGSWDR
AESYITYVLQDLQHSVNGWIDWNLMLNEIGGPNYANNYVESAVVVNATTGEEVYKQPIFY
GLGHFSRFITEGSVRVETTSDDSGMIVVGFLRPDNRTVLVFYNKKSSSCEVTIRDPERGL
TQLEIPAKSVHSILYA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgcatcttccaccaaaacagcttcgaccttgaacttgatcggcgctttactg
cgactggcgctgctttcgaccattgcaagcgtggtgatcggcagcggttacttcgatcga
gtggcgtcgttgccttgtgcgttacgtcagtacccgaccggttcggtgtgcgtgtgcaat
gtgacctactgcgatacgttggagttcgaggatccaagcaggccgggggagtttgtgctg
gtatcgagtagccgcaatgggaccagatttgggcagtcccgcggaaagttcgtgcaagcg
gacaatgcgacgttcttggcggcggtgcgtctgttacccaggcaacggatgacaaggagt
acgcgatcggtgatcattgaagttaaccgggagaagaggtatcagcggattgttgggttt
gggggtgcttttaccggggccgtttcgtacaacttggggctgttgaagccggagttgagg
aagagtatgtaccgatcgtattattcgaagaaggtgggcatcgggtacaatatgatgagg
attcctatcggaggatgtgatttcgatttgaaaccgtgggcgtacaacgagtcgccgacg
gatgacgcgaagctgtcgaacttcaccgaactggaccagagggatgtggagaagatagag
cagatcaaggaactgatggaggtgaccggaaatcgcgatatcaagttgatgggtgccgcg
tggagtccaccgaggtggatgaagtcgaacaacgattggagcggatccagtcggctaaaa
cccgagtactaccagacgtgggcagactatcacatccagtacttgcggctgatgaaggca
gctgggttgaactactgggcgatatctacgggtaacgaaccgatgaatgccgttatcggg
ttcttgttcattcgcttcatgagtctgggatgggtggcgacaaatcaaggaaaatgggtt
gccaagaacctagggccagcattgaagagctcagagttcaagaacgtcaaactgtttgcg
ggagatgatcagcgatacacatttccgtggtggttttcgcagatggatcagggtcatccg
gatgccacaaagttcgtggatgggttcgccgtgcattggtactgggacggagtgactcca
cccggtttgctcgatcaagcttctcacctgtatcctgacaaactaatcttcaacacagag
gcgtccctaggcgataagcccttccaaacgcatggccctatcctcggatcatgggatcgt
gctgagtcctacataacgtacgtcttgcaagatcttcaacacagcgttaacggttggatc
gactggaatttgatgttgaacgaaatcgggggtccaaattacgccaacaactacgtggag
tcggcagtcgttgtcaatgcgaccaccggcgaagaagtgtacaaacaaccgattttctac
ggattgggccacttctcgcgatttatcacggaaggatccgtccgagtcgaaacaaccagc
gacgattcggggatgatcgtagtaggcttcttgcgaccagacaataggactgttctagtt
ttctacaataaaaaatctagttcatgcgaggtgacgatccgcgatccggaacggggcctg
actcaactggagattccggccaagtcggtgcattccattctctacgcctaa

DBGET integrated database retrieval system