KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014502Help
Entry
AaeL_AAEL014502   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL014502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1072 aa AA seqDB search
MFTVLFAATPDDMWTPFKHLFNSIESFLAASGSGGGQQQEQNVASLDALLRKHKQNFTTL
LRNPPKNGKSREAIRVGITEGITLPEFGHTILSKDLVDESVIISDMYDLNEYIALELLCT
AQQQMPNHPGLPRGLVAVLLYYDGRKSLVASLKELFQARSGVSWCTDAPHEITQLITAYT
DGLVADGVLDKIVDLLGELDVTKELDVLTTNRALGPPKHHRQVLDLFEEIRVLLATCLFN
WAAQCGLPRGTTVKLIRYLAKYKSTVSSGGIDNVTLALQMALMYGLDMSVIQRREDGEEV
VKRLPMVKDPEFIETVMDAISSSWECEGLRSVSLFTFGLAIATLRLAPQNLYSNTAKIID
QDELLVDAAIQGRVFDFIHYTLLENEVIFRTEFYYRRMHVLFTDFIELMHSKVTELRARA
DETARTVQAFQQQGLDPPANLCRNFEALLLSVGKLYQNDQMRLNLSLEYWGPMEVAANYQ
RASSRSVCLFKFIRLAGELLPPILFIPYLKMLAGLSSCPQSARNAFNLLKQGGGASGSMA
TISWDHFFNSLFRYYQNLRQEQNPGSETVYRNRALSRNINPQEIAGLQAVLQVIRAVATH
DEVARVALCEHPNWAPLHVLLGLISCSVPISLKAELVQTLAALGKSKETALQLWNNLEAS
QVITTIPTTSTFANRGIESELEEIESRNETYPLTLGMLDLLYTLCETAIPRGLGAGPRKP
GLDPYVTFIIDAVFLRFYNRNYKNPTEKWQIAEKCLRLLNAFVQRYTPTPADFPSPTQNR
EENSPPGFHILLQINTKSDFLRLLLHIIDEACTLFDSYTPFPGRKHLETTCLFALQILER
ALETQEDFFNAHFSANCSILLAGANKLLLGMNPRSGKADHMLNIVRFVTYSSWLPENALV
SIRILTAIMRQPNVNQQILGLLTQSERIRNEIRQGFVECLESESVTFASTSQTSTDPSSD
GNDPDQDVEDYATAADAASAVSVELQIKEAIVGLLQECLPQQSTPNLAHYLLGFELNKEL
RLTNLQQPGVMNFPSNCAKSLITLLDNALEFSGGTIHINRLSFVINVLRPLL
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccgttttgtttgcagcaactccggacgatatgtggactccgttcaagcacctc
ttcaacagcatcgaatcgttcctggcggcgtccgggagtggaggtggtcaacagcaggaa
cagaatgtggccagtttggatgcgctgctgcggaagcacaagcagaatttcacaacactt
ttgagaaatccaccgaagaatgggaagagccgggaggcgattcgggtgggaattacggag
gggattacgctgccggagtttggacacacgatcctgtcgaaggatctggtggatgagagc
gtgatcatttccgatatgtacgacttgaatgagtacattgcgctggagttgctttgcacg
gcgcagcagcagatgccgaatcatcccggattgccgcgggggttggtggcggttttgctg
tattacgacggccggaagtcgctggtggcgagtttgaaggagctgtttcaggcgcgatcg
ggagtcagttggtgtacggatgcgccgcacgagattacgcagctgattacggcctacacg
gacggattggtggccgatggagtgctggacaagattgtggatttgctgggggagttggac
gtgaccaaggagctggatgtgctgacgacgaatagggccctggggccaccgaagcatcac
cggcaggtgttggatctgttcgaggagattcgggtgctgctggcgacgtgtttgttcaat
tgggccgcgcagtgcggattgccgagggggacgacggtgaagctgatccggtatctggcc
aagtacaagtcgacggtgtcgagcggagggattgataacgttacgctggcgctgcagatg
gcgttgatgtatggactggacatgagcgtgattcagcggagggaggatggcgaggaagtt
gtgaagcgacttccaatggttaaagatccggaatttatcgaaacggtgatggatgcgatt
tcgtcgagctgggaatgcgagggattgcggtcggtgtcgcttttcacgtttggattggcc
attgccacgctgagattggctccgcagaatctgtactccaacacagcgaagatcatcgat
caggatgaattgctggtggacgctgccattcagggaagggtgttcgatttcattcattac
accctgctggagaacgaggtgatcttccggacggaattctactaccggaggatgcacgtc
ttgttcacggatttcatcgagttgatgcattcgaaggtgacggaactgagggctcgagcg
gatgaaacggcaagaaccgtccaggccttccagcagcagggattggatccccctgccaac
ctgtgccggaattttgaggctctgctcctctccgtcggaaagctctatcagaacgaccaa
atgcggctgaatctatcactggaatactggggaccgatggaagtggccgccaactatcaa
cgggcttcctcccggtcggtttgcctcttcaaattcatccgtctggcaggggaattgctt
cctccaatcctattcattccttatctgaagatgctagccgggttatcgagctgtcctcaa
tctgcccggaacgccttcaacttgctcaaacaaggcggtggagcatccggatcgatggcc
accatttcctgggaccacttcttcaactccttgttccgctactatcagaacctccgccag
gagcagaaccccggaagcgaaaccgtctaccgcaatagggccctcagccgcaacatcaat
ccgcaggaaatagccggcctccaagccgtactccaggtgatccgagccgtggccacacac
gacgaagtggcccgagtcgccctatgcgaacaccccaactgggccccccttcatgtcctc
ctcggactgatcagctgctcggtccccatctccttgaaagcagaactcgtgcagactctg
gccgccctcggcaagagtaaagaaaccgccttgcagctctggaacaacctggaagcttcc
caggtcatcacaacgatccctaccaccagtacctttgccaatcgcggcatcgaatccgag
ctggaagaaatcgaatcccgcaacgaaacctaccccctgaccctcggaatgctcgacctc
ctgtacaccctctgcgaaacggccatccctcgaggcctcggtgccggccctcgcaaaccc
ggcctggacccctacgtcaccttcatcatcgacgccgtcttcctccggttctacaaccgc
aactacaagaaccccaccgaaaagtggcaaatcgccgagaagtgtctccgcttgctgaac
gccttcgtccagcgctacactcccacccccgctgacttcccctccccgacccagaaccgc
gaggaaaactccccgcccggattccacatcctgctccaaatcaacaccaagtcggatttc
ctccgtctcctcctgcacatcatcgacgaagcctgcaccctcttcgattcctacacgccc
ttccccggtcgcaaacacctcgagaccacctgcctcttcgccctccaaatacttgaacgc
gccctcgaaactcaagaggacttcttcaacgcccacttctccgccaactgctccatcctc
ctggccggagccaacaagctcctcctcggaatgaacccccgcagcggcaaggcggaccac
atgctcaacatcgtccgcttcgtcacctacagctcctggctcccggagaacgccctcgtc
tccatccggatcctcacggccatcatgcgccagccaaacgtcaaccagcagatcctcggt
ctgctcacgcagtccgagcgaatcaggaacgagatccgccagggcttcgtcgaatgcctc
gaaagcgagtcggtgacattcgcctccacttcccaaacttccacggatccttccagcgac
ggaaacgaccccgatcaggacgtggaggactacgcgacggcggcggacgctgcctccgcg
gtcagcgtcgagctccagatcaaggaggccatcgttgggttgctgcaagagtgtttaccg
cagcagagtacgcccaatttggcgcactatctgctcgggttcgagctgaacaaggaactg
cggttgacgaatctgcagcagccgggcgtaatgaattttccgagcaactgcgccaagtcg
ctgattacgctgctggataatgcgctggagttttccggtggtactatccacataaatcgg
ctgtcgtttgtgatcaacgtcttgcgtcctttgttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system