KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014502Help
Entry
AaeL_AAEL014502   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL014502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1072 aa AA seqDB search
MFTVLFAATPDDMWTPFKHLFNSIESFLAASGSGGGQQQEQNVASLDALLRKHKQNFTTL
LRNPPKNGKSREAIRVGITEGITLPEFGHTILSKDLVDESVIISDMYDLNEYIALELLCT
AQQQMPNHPGLPRGLVAVLLYYDGRKSLVASLKELFQARSGVSWCTDAPHEITQLITAYT
DGLVADGVLDKIVDLLGELDVTKELDVLTTNRALGPPKHHRQVLDLFEEIRVLLATCLFN
WAAQCGLPRGTTVKLIRYLAKYKSTVSSGGIDNVTLALQMALMYGLDMSVIQRREDGEEV
VKRLPMVKDPEFIETVMDAISSSWECEGLRSVSLFTFGLAIATLRLAPQNLYSNTAKIID
QDELLVDAAIQGRVFDFIHYTLLENEVIFRTEFYYRRMHVLFTDFIELMHSKVTELRARA
DETARTVQAFQQQGLDPPANLCRNFEALLLSVGKLYQNDQMRLNLSLEYWGPMEVAANYQ
RASSRSVCLFKFIRLAGELLPPILFIPYLKMLAGLSSCPQSARNAFNLLKQGGGASGSMA
TISWDHFFNSLFRYYQNLRQEQNPGSETVYRNRALSRNINPQEIAGLQAVLQVIRAVATH
DEVARVALCEHPNWAPLHVLLGLISCSVPISLKAELVQTLAALGKSKETALQLWNNLEAS
QVITTIPTTSTFANRGIESELEEIESRNETYPLTLGMLDLLYTLCETAIPRGLGAGPRKP
GLDPYVTFIIDAVFLRFYNRNYKNPTEKWQIAEKCLRLLNAFVQRYTPTPADFPSPTQNR
EENSPPGFHILLQINTKSDFLRLLLHIIDEACTLFDSYTPFPGRKHLETTCLFALQILER
ALETQEDFFNAHFSANCSILLAGANKLLLGMNPRSGKADHMLNIVRFVTYSSWLPENALV
SIRILTAIMRQPNVNQQILGLLTQSERIRNEIRQGFVECLESESVTFASTSQTSTDPSSD
GNDPDQDVEDYATAADAASAVSVELQIKEAIVGLLQECLPQQSTPNLAHYLLGFELNKEL
RLTNLQQPGVMNFPSNCAKSLITLLDNALEFSGGTIHINRLSFVINVLRPLL
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccgttttgtttgcagcaactccggacgatatgtggactccgttcaagcacctc
ttcaacagcatcgaatcgttcctggcggcgtccgggagtggaggtggtcaacagcaggaa
cagaatgtggccagtttggatgcgctgctgcggaagcacaagcagaatttcacaacactt
ttgagaaatccaccgaagaatgggaagagccgggaggcgattcgggtgggaattacggag
gggattacgctgccggagtttggacacacgatcctgtcgaaggatctggtggatgagagc
gtgatcatttccgatatgtacgacttgaatgagtacattgcgctggagttgctttgcacg
gcgcagcagcagatgccgaatcatcccggattgccgcgggggttggtggcggttttgctg
tattacgacggccggaagtcgctggtggcgagtttgaaggagctgtttcaggcgcgatcg
ggagtcagttggtgtacggatgcgccgcacgagattacgcagctgattacggcctacacg
gacggattggtggccgatggagtgctggacaagattgtggatttgctgggggagttggac
gtgaccaaggagctggatgtgctgacgacgaatagggccctggggccaccgaagcatcac
cggcaggtgttggatctgttcgaggagattcgggtgctgctggcgacgtgtttgttcaat
tgggccgcgcagtgcggattgccgagggggacgacggtgaagctgatccggtatctggcc
aagtacaagtcgacggtgtcgagcggagggattgataacgttacgctggcgctgcagatg
gcgttgatgtatggactggacatgagcgtgattcagcggagggaggatggcgaggaagtt
gtgaagcgacttccaatggttaaagatccggaatttatcgaaacggtgatggatgcgatt
tcgtcgagctgggaatgcgagggattgcggtcggtgtcgcttttcacgtttggattggcc
attgccacgctgagattggctccgcagaatctgtactccaacacagcgaagatcatcgat
caggatgaattgctggtggacgctgccattcagggaagggtgttcgatttcattcattac
accctgctggagaacgaggtgatcttccggacggaattctactaccggaggatgcacgtc
ttgttcacggatttcatcgagttgatgcattcgaaggtgacggaactgagggctcgagcg
gatgaaacggcaagaaccgtccaggccttccagcagcagggattggatccccctgccaac
ctgtgccggaattttgaggctctgctcctctccgtcggaaagctctatcagaacgaccaa
atgcggctgaatctatcactggaatactggggaccgatggaagtggccgccaactatcaa
cgggcttcctcccggtcggtttgcctcttcaaattcatccgtctggcaggggaattgctt
cctccaatcctattcattccttatctgaagatgctagccgggttatcgagctgtcctcaa
tctgcccggaacgccttcaacttgctcaaacaaggcggtggagcatccggatcgatggcc
accatttcctgggaccacttcttcaactccttgttccgctactatcagaacctccgccag
gagcagaaccccggaagcgaaaccgtctaccgcaatagggccctcagccgcaacatcaat
ccgcaggaaatagccggcctccaagccgtactccaggtgatccgagccgtggccacacac
gacgaagtggcccgagtcgccctatgcgaacaccccaactgggccccccttcatgtcctc
ctcggactgatcagctgctcggtccccatctccttgaaagcagaactcgtgcagactctg
gccgccctcggcaagagtaaagaaaccgccttgcagctctggaacaacctggaagcttcc
caggtcatcacaacgatccctaccaccagtacctttgccaatcgcggcatcgaatccgag
ctggaagaaatcgaatcccgcaacgaaacctaccccctgaccctcggaatgctcgacctc
ctgtacaccctctgcgaaacggccatccctcgaggcctcggtgccggccctcgcaaaccc
ggcctggacccctacgtcaccttcatcatcgacgccgtcttcctccggttctacaaccgc
aactacaagaaccccaccgaaaagtggcaaatcgccgagaagtgtctccgcttgctgaac
gccttcgtccagcgctacactcccacccccgctgacttcccctccccgacccagaaccgc
gaggaaaactccccgcccggattccacatcctgctccaaatcaacaccaagtcggatttc
ctccgtctcctcctgcacatcatcgacgaagcctgcaccctcttcgattcctacacgccc
ttccccggtcgcaaacacctcgagaccacctgcctcttcgccctccaaatacttgaacgc
gccctcgaaactcaagaggacttcttcaacgcccacttctccgccaactgctccatcctc
ctggccggagccaacaagctcctcctcggaatgaacccccgcagcggcaaggcggaccac
atgctcaacatcgtccgcttcgtcacctacagctcctggctcccggagaacgccctcgtc
tccatccggatcctcacggccatcatgcgccagccaaacgtcaaccagcagatcctcggt
ctgctcacgcagtccgagcgaatcaggaacgagatccgccagggcttcgtcgaatgcctc
gaaagcgagtcggtgacattcgcctccacttcccaaacttccacggatccttccagcgac
ggaaacgaccccgatcaggacgtggaggactacgcgacggcggcggacgctgcctccgcg
gtcagcgtcgagctccagatcaaggaggccatcgttgggttgctgcaagagtgtttaccg
cagcagagtacgcccaatttggcgcactatctgctcgggttcgagctgaacaaggaactg
cggttgacgaatctgcagcagccgggcgtaatgaattttccgagcaactgcgccaagtcg
ctgattacgctgctggataatgcgctggagttttccggtggtactatccacataaatcgg
ctgtcgtttgtgatcaacgtcttgcgtcctttgttataa

DBGET integrated database retrieval system