KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014508Help
Entry
AaeL_AAEL014508   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AaeL_AAEL014508
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AaeL_AAEL014508
Ubiquitin system [BR:aag04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     AaeL_AAEL014508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 688 aa AA seqDB search
MIVQEPVQAAIWHCLNHYDYQDAIFLAERLCAEVESEESLFLLATCYYRAGQKHQAHWLL
SSKSVRSTQCRFLLSKCAFDLKQYSEAEHTLINDDHLRVRHMDEVAKEFGDIGCFALELI
SKICQKTERANLANDASRKAVKLNPFLWQSFADLCNRGEKPDPNSVFQLTSTDVFATSQA
TNPAMNSSMVWFGNGTGGGTGGGGEGGTFIASDSIEQQLVSTPDQVSQCLIQNIINTPNN
PPQQQAQGQNISSLANMRMGGGNLNSSGVVPADQTPNVGGDIGTPFRKQQFKYLAALSPS
TPSFGVLPIMNSPILHDQSALIMTPSPQQLSSATGYQQQSQQQQISGQQQVGQQQQQIIA
ESDQQKMALSSSNKKMRGHHNLGTMGIIINRKSDTTASPMLLQQQSTNTKPNVFSQTGNQ
MTTPRTPNTTGAPILTSQYVRRSSRLFSNSNCSVKENTKSPQLNNKFVAPRSPPRKSKQR
ISKNLNSSTANLLENVERKSSTGGDGKEKIETITSSETLSEKVFINNSINSAQKVAQQVL
AMKKQSADGLMTLLRELGQGYLRLQSYDCEKAIEHFSNVPPHHYNSSWVQSMIALAHHEM
REYEAAVNIFREIHDKEPHRLQYMEIYSTDLWHLQKDVVLSALAQDLMAQDKSSPITWCV
AGNCFSAHKEHETAIKFFFRAIQVGGVL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtacaggaaccagtgcaggctgcaatatggcactgcctgaaccactacgactat
caggatgcgatcttcctggcggaaagactgtgtgccgaagtggagtccgaggagagttta
ttcctattagcgacctgttattaccgggccggccagaagcatcaggcccactggttactg
tcgtcaaaaagtgttcgctcgacgcagtgtcggtttctcctctccaagtgtgccttcgat
ctgaagcaatactcggaagcggagcacacgttgatcaatgatgatcatcttagggtacgg
cacatggacgaggtggccaaagagttcggtgacatcggttgtttcgctttggagctgata
tccaagatctgccagaagactgaacgagcaaatctggcaaacgatgccagtagaaaggcc
gtcaagttgaatcccttcctgtggcaatcttttgccgatctgtgcaaccgaggggagaaa
ccggatccgaacagtgtgttccagttaaccagcaccgatgtgtttgcaactagtcaagcc
acgaatccggctatgaactcgtcgatggtgtggttcggaaacggaactggcggagggaca
ggtggcggaggagaaggaggaacgtttattgcatcggacagtatagagcagcagttggtc
agcacaccagatcaggtttcacagtgtctaatacaaaatataatcaacacaccaaataat
cctccgcagcaacaagcacagggtcaaaatattagcagtttagcaaatatgagaatggga
ggaggtaatctgaattctagtggggtagtgcctgcagatcagacgcccaacgtgggtgga
gatattggaacgcccttccggaagcagcagttcaaatacctggctgcgttgagtccctca
actcccagctttggcgtcctaccaattatgaacagcccaattttacacgaccagtctgcg
ttaataatgacaccttcaccacagcagctttcctcggctacgggatatcagcagcaaagc
cagcaacaacagatatcaggacagcaacaggtcggtcagcaacagcagcaaatcatcgcc
gaaagcgatcagcaaaagatggctttgtcgagtagtaataagaagatgcgaggacatcac
aatttaggcacgatggggatcataatcaatcgtaagagtgataccacggcatctcccatg
ctcctgcagcaacagagcacgaacacaaagccaaatgtgtttagtcaaacaggcaaccaa
atgacgacgccgcggacaccgaacacaactggggctccgatcttgacatcccaatacgtt
cgccgaagttcccgccttttcagtaacagtaattgctccgtcaaagagaataccaaaagt
ccccaattgaacaataagtttgtggcccctcggtcgccaccgcgcaagtcgaagcagcga
atctcaaagaacctgaacagcagtacggcaaacctgctggagaatgtcgaacggaagtct
tccaccggtggcgacggaaaggagaagatcgaaaccatcacttcgagcgagacgcttagc
gaaaaggtgttcatcaacaatagcataaacagtgcgcaaaaggtggctcagcaggtactg
gcaatgaagaagcaaagtgccgatggcttgatgacgctgctgcgggaactaggccaggga
tacctccggttacagagctacgactgtgagaaggcgatcgagcatttcagtaacgttcca
ccccatcactacaacagtagttgggtgcagagtatgatagcgttggcacatcacgagatg
cgagagtacgaagcggcggtcaacatcttccgggagatacacgacaaagaaccgcaccgg
ttgcagtacatggagatctacagtacggacttgtggcacctgcagaaggacgtggttctg
tcggcgctggctcaggacctgatggcgcaggacaagagctcaccgattacgtggtgcgtc
gctgggaattgtttctcagcccacaaggaacatgagacggcaatcaagttcttctttcgt
gcaatacaggtaggtggagttttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system