KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014523Help
Entry
AaeL_AAEL014523   CDS       T01053                                 

Definition
neuroendocrine convertase
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     AaeL_AAEL014523
Peptidases [BR:aag01002]
 Serine Peptidases
  Family S8: subtilisin family
   AaeL_AAEL014523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 629 aa AA seqDB search
MVLCCLVVLTKGKSASGNVFTSSFLVKFKRNVDNQKAHEIADRNGFVNLGPLAGSAGREF
HFKHMALPHARTRRSIAHMRVLKKEALVNTAVQQVGFKRVKRGLRTSIPSSFVTDPSDPN
VGKAPTDPYFPLQWYLRNTGQNGGKPRLDLNVQAAWDQGITGKNVTTAIMDDGVDYMHPD
LKFNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIA
GIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEG
RNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFS
NGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPSLTWRDIQHLTVLTS
KRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAIVSLAKKWRTVPPRYHCEAGAIMD
PHPISSTGAVMLRIKTDACRGTDTEVRYLEHVQAVITANATRRGDLELFVTSPMGTRSMI
LSKRANDDDHRDGFTKWPFMTTHTWGEYPQGTWLLEATFNSKEPRSGWIKEFSLVLHGTK
DPPYRMLSPASPHSKLAIVKKAHEDQDKM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggtgctatgctgcttagtggtattaactaaaggcaaatcggcttccggcaacgttttc
accagttcgttcttggtaaaattcaaacgcaatgtggataatcaaaaggctcatgaaatc
gctgatcgcaatggatttgtcaatcttggcccgctcgcaggaagtgccggacgagagttt
cactttaaacatatggcccttccacatgccagaactcgacgaagtatagcccatatgagg
gttctgaaaaaggaagcattggtgaacactgctgtgcaacaagttggattcaaacgtgta
aagcgaggattacgtacttcaattccatcatcattcgtgacggatccttctgatcctaat
gttggaaaagctccgactgacccatattttccactacagtggtatttacggaacactggg
caaaatggaggaaaaccacgtcttgacttaaacgtgcaagctgcatgggaccaaggaatt
actgggaaaaacgtaactacggcaattatggatgacggtgtcgattatatgcatccagat
ttgaaattcaattataatgcagaagcaagctacgattttagcagcaatgatccatacccg
tatccgagatatacggatgattggttcaacagccatggtactcgatgtgctggagaggtt
gccgcagcacgagataacggaatttgtggagtaggcgttgcgtatgattccaagatcgcc
ggaatacgcatgttagatcaaccctatatgactgatcttattgaggcgaactccatgggt
cacgagccacataaaatacacatctacagtgcatcgtggggaccaacagatgacggtaaa
actgtggacgggccaagaaatgctactatgagggctattgtacagggtgtaaatgaaggc
cgcaacggactggggaatatctatgtgtgggcttcgggtgatggtggtgaagaggatgac
tgtaactgtgatggatatgcagcatcaatgtggacgatatcaataaacagtgctatcaat
gatgggcaaaacgctcattatgatgaaagttgcagctccacgctagccagtacgtttagc
aatggagcgaaggatcctaatacaggcgtggcaaccacagatttatatggaaaatgtaca
accacgcactctggtacaagtgcggcagctccagaagcggccggagtttttgcgcttgcc
ttagaagcaaatccttccctaacatggcgtgatattcagcatcttacggtactcacatcg
aagcgtaattctttattcgatgctaaaaatcgcttccattggacaatgaatggagttggt
ttggaattcaatcatctgtttgggtttggcgtactagatgcaggtgcaatagtctctctg
gctaagaaatggcgcactgtgccacctcggtatcactgtgaagcaggtgctatcatggat
cctcaccccatttcatccactggtgcggtgatgttacgtattaaaacagatgcctgccga
ggaactgatactgaagttcgctatttagagcatgtgcaggcagttatcacggcaaatgct
actaggaggggagatttggagttatttgttacgtctcccatgggaacaaggtccatgata
cttagcaaacgagcaaatgatgacgatcatagggatggatttacaaagtggcccttcatg
acgactcatacgtggggcgaatatcctcaaggaacatggttattagaggcaactttcaac
tcaaaggaaccacgatcaggatggataaaggaattttctttggtgttgcatggaacaaag
gaccctccgtacaggatgttgtctccggcttctccacattcgaaattggctatcgtcaaa
aaagctcatgaagaccaagacaaaatgtaa

DBGET integrated database retrieval system