KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL014729Help
Entry
AaeL_AAEL014729   CDS       T01053                                 

Definition
protein serine/threonine kinase, putative
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AaeL_AAEL014729
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   AaeL_AAEL014729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 374 aa AA seqDB search
LPSSPFLKKLGFGTGVEVLRIKRSPTKNSTRSPWAIKMLSRRNDPENAKLFGDRLTEEAG
ILKQLSHPNIVGYRGFDSLEAGKEYIAMEYCNTSLGDLLQARYDDGLGSLEAAKIQRMSL
DILNALDYLHTEALILHGDLKSFNILVKNDFEICKLCDFGVSLPLTKEGFLDTEKKKDAQ
YVGTGIWSAPEVLEEDVTLISSKADIFSFGLVVYETISLLPPHTFPGMMDESIASSADYA
SEQPAKKAAPEPDSTTDSTVISVPDDSITTVDDSAITIDDDDEEGEEEEDDAIEDEDEDE
EYDEDEEGDYLDYGRLGTRPAIPDGINLSDEYNFILEMFYVCTQEDYEARPSAKTLLEAW
HKKTGNGALATASD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ctgccgtcgtctccatttctgaagaagctcggcttcgggacgggcgtggaagtgctccga
ataaagcggtccccaacgaagaactccacccggtcgccatgggccatcaagatgctgtcg
cggcggaacgatccggagaatgccaaacttttcggggaccggctgaccgaggaggcgggc
atcctgaagcaactcagccatccgaacattgtcggatatcggggatttgattcgctggaa
gccggaaaggaatacatcgcgatggagtactgcaacacttccctgggggatttgctgcag
gcgcggtacgacgatgggttgggctccctggaggcggcaaagatccagcgaatgtcattg
gacattctgaatgccttggattatttgcacacggaagccctgatcctgcacggagatttg
aaatccttcaatatcctggtcaagaacgacttcgagatttgcaagctgtgtgatttcggc
gtaagtttgccccttactaaggagggattcctggacacggagaagaaaaaggacgcccaa
tacgtgggaacaggaatttggtccgctccggaagtcctagaggaagatgtgacgctaatc
agttccaaagcggacattttcagttttgggttggtggtttacgaaactatttccctgctg
ccgccgcacacgttcccggggatgatggacgaaagcattgccagctcggcggattacgcc
agtgaacaacccgcgaagaaagcggctccggagccggattcaacgacggacagcacggtg
ataagcgtgccggatgacagtattacgacggtggacgatagcgccatcacaatcgacgat
gatgatgaagaaggtgaggaagaggaagacgacgcgatagaggatgaggacgaagacgag
gagtacgatgaggacgaggaaggagattacctggactacggaaggctgggaaccagaccg
gccattccggacggtatcaacctctccgatgagtacaattttatcctggagatgttttac
gtgtgcacgcaggaggactatgaggcgagaccatcggcaaagaccctgctcgaggcctgg
cacaagaagaccgggaatggggcactggcgacggccagtgac

DBGET integrated database retrieval system