KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL015010Help
Entry
AaeL_AAEL015010   CDS       T01053                                 

Definition
acetyl-coa synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aag01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aag00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aag00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aag00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 668 aa AA seqDB search
MPSEPKVFNPHPDVADKAYINSMEQYQEFYRQSIENPGQFWSNVAKQFHWETPYDPKNFF
SYNFDISKGPIFVKWMEGASTNICYNLLDRNVKNGLGDTVAYYWEGNHPDDYSRLTYRKL
LEEVCRFANVLKAHGVQKGDRVSIYMPMTMELPVAMLACARIGAVHSIVFAGFSSDSLAE
RMHDCQAKVLITADGAWRGEKILHLKDLCDQALIKADEMGHHVETCIVVAHINRVTPGKP
DWDGVFDTPWTDDRDYWWHQEMEDAEPACYPEWMAAEDPLFMLYTSGSTGKPKGVLHTTA
GYLMYAATTFKIVFDYKPHDVYWCTADIGWITGHTYVLYGPLANGATSVMFEGTPFFPDN
DRYWEVVDKYKVTQFYTAPTAIRSLMKYGDEPVMKHDLSSLRVLGSVGEPINPEAWMWYY
KVVGKEKCAIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDESGNEIKGE
GEGYLVFSQPWPGMMRTLFNNHPRYESTYFSKFNGFYCTGDGARRDADGYYWITGRVDDM
LNVSGHLMSTAEVESVLTEHSRVSEAAVVSRPHPVKGECLYCFITPNQNEAFDKTLINEL
KILVRERIGPFAQPDVIQHAPGLPKTRSGKIMRRVLRKVAINDREVGDTSTLADEAIIEQ
LFANRPVA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgccctcggaaccaaaggttttcaacccgcaccccgatgtcgccgacaaggcgtacatc
aatagcatggaacagtaccaggaattttatcggcagtccatcgaaaatccggggcagttc
tggagcaatgtagcgaagcagttccactgggagactccttatgatccgaagaacttcttc
tcgtacaacttcgatatctctaagggtccgatcttcgtgaagtggatggaaggcgcctcg
accaatatctgctacaacttgctggaccgaaatgttaaaaatggcctgggtgatactgtg
gcctattactgggaaggaaatcacccggatgactacagccgcctcacgtaccgcaagctg
ctcgaagaggtgtgccgttttgccaacgtcctgaaggctcatggcgtccagaagggcgat
cgcgtgtcgatctacatgcccatgacgatggagctgccggttgcgatgttggcctgtgct
cggatcggtgccgtgcactcgattgtgtttgcaggtttctcatcggattcgttagctgag
cggatgcacgattgccaagcgaaggtgctaatcaccgccgatggagcctggcgtggggag
aaaatccttcatctgaaggatttgtgcgatcaggcgctgatcaaggccgatgaaatggga
caccatgttgagacctgtatcgttgtggcgcacattaatcgagtaactcccggtaaacct
gactgggatggagtgttcgatactccatggacggacgatcgcgattattggtggcatcaa
gaaatggaagatgctgaaccggcctgctatcccgagtggatggcagcggaggatccgctg
ttcatgttgtacaccagtggatcaacgggcaaaccgaagggcgttctgcacactacagcc
ggatatctgatgtacgcggcgacgaccttcaaaattgtgttcgactacaagccccatgac
gtgtactggtgcactgctgatattggttggatcaccggccatacctacgtgctgtatgga
ccgctggcaaacggcgccacgtcggtgatgttcgagggtactccgttctttccggataac
gatcgctactgggaagtggtggacaagtacaaggttacgcagttctacacggcaccgacg
gcgatacgatcgctgatgaagtacggcgacgagcctgtgatgaaacatgatctttcttcg
ttgagggtactcggaagtgtcggtgaaccgatcaaccccgaagcgtggatgtggtactac
aaagtagtaggcaaggagaagtgtgctattgtggatacgttctggcagacggaaactggg
ggacatgtgataactccgctaccaggagctactccaatgaagccaggatcagcttctttc
ccattcttcggagtaaaaccaaccctgctggacgaaagtggcaacgaaatcaagggcgaa
ggagaaggttatctggttttctcgcagccatggcccggaatgatgcgaacactgttcaac
aaccacccacgatatgagtccacgtatttctccaagttcaatggcttttactgcactgga
gatggtgctcgacgagatgccgacggatactactggatcacaggccgcgtggacgacatg
ctcaacgtttccggccatctgatgtctaccgctgaagtggaatccgtactaaccgagcat
tctcgcgtatcggaagctgctgttgtgtcacgacctcaccccgttaaaggcgagtgcctg
tactgtttcatcacccccaaccagaacgaagccttcgacaagacgcttatcaacgaattg
aagatattggttagggaacgcattggcccatttgcccagccggacgtaatccagcatgct
ccaggactcccaaagacgcgatccggcaagatcatgcgacgtgtactgcgaaaagttgcg
atcaacgatcgggaggtcggagacacttcaacccttgccgacgaagcgatcattgagcag
ctcttcgccaaccgaccggtagcttaa

DBGET integrated database retrieval system