KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL015291Help
Entry
AaeL_AAEL015291   CDS       T01053                                 

Definition
aldose 1-epimerase, putative
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AaeL_AAEL015291
Enzymes [BR:aag01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AaeL_AAEL015291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 246 aa AA seqDB search
SKLAVFDGKKAIRGGIPFVFPQFGPWNFGPQHGFGRVVRWTLERAPERLPSGDVEAVFSL
MDNEITRSMWNYPFRITYRLILREKELHFHIGVYNPSKDLTFSFNLLLHTYLKVPDVRRC
QITGLHGCTFIDKTRDGAIYQEGRDVVTINEWTDRIYQHTPQEHIITNVVSGRKMRLQKY
NFPDTVVWNPWMDKARECQDFGDDEYPNMICVEAGHVSTPVILLPGTAFEASQILQVGVL
ANLILI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
agtaaactagccgtattcgatggcaagaaagcgatacgaggaggcataccatttgtattt
cctcaattcggcccctggaactttggaccacagcatggcttcggacgagtggtacgatgg
acgctagaacgggcaccggaacgcctgcccagtggagacgtagaagcagtcttcagcctg
atggacaacgaaatcacacgatccatgtggaactacccctttcgcataacgtatcgattg
atcctccgagagaaggaacttcacttccacattggggtgtacaaccccagcaaggacctg
acgttctcgttcaacctgctgctgcacacatacctgaaggtcccggacgtcagacggtgt
cagattaccggcctgcacgggtgtacttttatcgataagactagagatggtgctatctat
caggaaggacgtgatgtagtgacaatcaacgaatggacggatcgaatctaccaacacaca
ccccaggaacacattatcaccaatgtcgtgtccggtagaaaaatgcggttgcagaagtac
aacttccccgataccgttgtgtggaatccctggatggacaaagcccgagagtgccaagat
tttggtgatgatgaatacccgaacatgatctgcgtagaggctgggcacgtgtctactccg
gtcatcctccttcccggtaccgcgttcgaggcaagccaaatacttcaggtgggtgtcctg
gctaaccttattttgatctag

DBGET integrated database retrieval system