KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL015549Help
Entry
AaeL_AAEL015549   CDS       T01053                                 

Definition
calcineurin b subunit
Orthology
K17610  
calcineurin B homologous protein 1
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AaeL_AAEL015549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 166 aa AA seqDB search
TPNQIERLYSRFTSLDRSDCGTLTREDFLRIPELAINPLCERIVHSFFADSSDDRVNFRQ
FTQVLAHFRPIKPNKENKLNSREEKLRFAFKMYDLDDDDNISRDELLSILQMMVGANISQ
DQLNSIAERTIVEADSMGQGKITFEDFCRALERTDVEQKMSIRFLN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
acgccgaaccagattgaacggttgtattcgcgattcacatcgctggatcgcagcgattgc
gggactttaacgcgggaggatttcctgcgcattccagaactggccatcaatccgttgtgc
gaacggatcgttcactcgttcttcgccgacagcagcgacgatcgggtcaacttccgccag
ttcacacaagtgctggcccatttccggccgatcaagcccaacaaggagaacaagttgaac
agccgcgaggagaagctccggttcgcgtttaagatgtacgacttggatgacgacgataac
atctcgcgggacgagctgctcagcattctgcagatgatggtcggggccaacataagccag
gatcagctgaacagcattgccgagcggacgatcgtcgaggcggactcgatgggacagggc
aagatcacgttcgaggacttttgccgggcgctggagcgcaccgacgtcgagcagaagatg
tccattcggttcctgaactga

DBGET integrated database retrieval system