KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL015631Help
Entry
AaeL_AAEL015631   CDS       T01053                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AaeL_AAEL015631
Enzymes [BR:aag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AaeL_AAEL015631
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C44
   AaeL_AAEL015631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 563 aa AA seqDB search
MCGIFSIFLNERHRRLYGGETDLCGRKESLRELAFRQSARQRHRGPDHTGLVADEDEGFV
LVQERLCVIGVKTGTQPFVSQDGQVLLVANGEIYNYLLMAQEINDALKAGESTYTPRSDC
DVIIAYYEKFGVDALMKNIRGMFAFVLYDKKNGNILVARDPIGIVPLYSGKDVEGNLWIA
SEMKCLVEKCSEVEIFPPGHMYYGSRQKLKPVSYFDSDWMYEIPRAKVDLERLKKSLEDA
VESHLQCDVPMGALLSGGLDSSLIASIATKIMKKRHGPDYRLKTYSVGLVGGPDFEFARM
VADYIGSDHTEVYFTIDEGLNYIRDAVLHGETYDITTVRCTIPLLLLSRYIKSEGIKMVL
SGEGADELFGGYLYFHQAPNAEEFHFETVKRVQNLHYSDCLRANKGTSAWGLELRVPFLD
TDFVNYVMSIRPEDRKPQNKINGLVQPMEKYILREAFAEDYLPQKVLWRQKEQFSDGVGY
TWIDTITKYAASHISDAEFSSAAARFPINPPPTKEAYYYRQIFEELFPHESCASTVTRWV
PRTDWGCSADPSGRKQTIHKENV
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattttttcgatatttctcaacgagcgacaccgtcgtctttatggcggtgaa
acagatctgtgtggaaggaaagagtccctgcgggagttggccttccgacagtcggccaga
cagaggcaccgtggtccggatcacaccggtttggtggctgacgaggacgaaggatttgtg
ctagtccaggagagactgtgtgtgattggggtgaaaacgggaactcaaccgttcgtgtcc
caggatggccaagtgctgttggtggccaatggcgaaatctacaactatctgctgatggca
caggaaatcaacgacgcacttaaggcaggggagagcacctacactccgagaagtgattgc
gatgtcatcattgcatattacgagaagtttggcgttgatgcactcatgaagaatatacga
ggcatgttcgcatttgttctgtacgacaagaaaaacggcaatattctggtggcgcgtgac
ccgattggaatagttccactctacagtgggaaagacgttgagggcaacttgtggatagcc
agtgaaatgaagtgtttagtggaaaagtgctcagaagtagagatattcccgccaggccac
atgtactatggctcgagacaaaagttgaaaccagtgagctattttgactctgattggatg
tacgagatccctcgagcaaaggtggatttggaacggttgaaaaagagtctggaggatgca
gttgaatctcatttgcagtgtgacgttccgatgggagcattgctcagtggtggtctggat
tcgagcttaatcgcgtccatagccacaaaaattatgaaaaaacgacatgggccagattat
cgattgaaaacctacagcgttggacttgtcggtggaccagatttcgaatttgcacgcatg
gttgccgactacatcggaagtgatcacacagaggtgtactttacgatcgacgaaggactc
aactatattcgcgatgctgttctacacggagaaacctacgacatcacgacggttcgctgc
accattccgttgctgttgctttcgaggtacatcaaaagcgaaggtatcaaaatggtactc
tccggtgagggagcagacgagctattcggaggatacctctactttcatcaagcgccaaat
gcagaagaattccacttcgaaacggtaaagcgtgtgcagaacctccattactcagattgt
cttcgtgcaaacaagggaacttccgcatggggcctggaattgcgtgtccccttcctggat
acggactttgtcaactatgtgatgagcatccgcccggaagatcgcaagccccagaacaaa
atcaacggtttggtacaacccatggagaagtacatcctgcgggaagctttcgctgaggat
tatcttccgcaaaaagtcctctggcgacagaaggagcagttttccgatggagttggttac
acgtggatcgataccatcaccaagtacgcggcgtcccacatcagtgatgccgaattttct
tccgcggctgcacgattccccatcaacccgccgccaaccaaggaggcttactactaccgg
cagatcttcgaggagctgttcccacatgagagctgtgcgtcaaccgtcaccagatgggtg
ccccggacagattggggctgctccgcagatccatccggtcggaagcagacgatacacaag
gagaatgtgtga

DBGET integrated database retrieval system