KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL015684Help
Entry
AaeL_AAEL015684   CDS       T01053                                 

Definition
(RefSeq) AAEL015684-PA
  KO
K11252  
histone H2B
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AaeL_AAEL015684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
Position
3
AA seq 333 aa AA seqDB search
MTETAVEVAAVAPAVKAPKKIKVAEKDANKLKKQPTHPPVNEMVIAALSNLKERKGSSLQ
AVKKYIGANYDCDVIRLYTFIRRALKTGVEKGTLIQTKGTGATGSFKLVDKKKASVEKKP
KKAVSEKKEAVKKAAGDKKVKKLATKKATGVKKAKAVKTGTAKKAAPSKQKSTKPSKAAA
ATKPKTPKPKKIAPAKKAASKKVAAKNHLKMAPKTSEKAAKKSGKAQKSVVKGDKKKKVR
RKESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSR
EIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaccgccgtcgaagttgccgccgtggctccagcagtaaaagcgcctaagaag
atcaaagtcgctgagaaagacgctaacaagctgaagaagcaaccgactcatccaccagtg
aacgaaatggtcattgccgctctcagcaacttaaaggaacgtaaaggatcttctctgcag
gctgttaaaaagtacatcggtgccaattacgattgcgacgtgatcaggttgtacaccttc
atccgaagggctctgaaaactggcgtcgagaagggaactctaatccagaccaagggaacc
ggtgcgactggatccttcaagctggtggacaagaagaaggcgtccgttgagaaaaagcct
aaaaaggctgtcagtgagaagaaggaggctgtcaaaaaagctgcgggcgataagaaggtc
aagaaactggccaccaagaaagcgacgggtgtgaagaaagccaaagctgtgaagactggc
actgcgaagaaggctgctccttccaagcagaagtctaccaaaccatcgaaggccgctgct
gccacgaagccaaaaaccccgaagccgaagaaaatcgctccggccaaaaaagccgcctcg
aagaaagtcgccgctaaaaatcatttgaaaatggcaccgaaaacaagtgaaaaagctgcg
aaaaagtccggcaaggctcagaagagcgtcgttaagggagataagaaaaagaaggtacgc
cgcaaggaaagctacgccatctatatttacaaggtgctgaaacaggtccacccggacacc
ggagtttcatcgaaggccatgagcatcatgaacagcttcgtcaacgacatcttcgagcgg
atcgctgctgaggcttcccgtttggctcattacaacaagcgttcgacgataacgtctcgt
gaaattcaaaccgctgttcgtttgctgttgccgggagaattggccaagcatgccgtctcc
gagggtaccaaggccgtcaccaagtacaccagctcaaagtaa

DBGET integrated database retrieval system