KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL015684Help
Entry
AaeL_AAEL015684   CDS       T01053                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
aag  Aedes aegypti (yellow fever mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 123 aa AA seqDB search
MAPKTSEKAAKKSGKAQKSVVKGDKKKKVRRKESYAIYIYKVLKQVHPDTGVSSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaaaacaagtgaaaaagctgcgaaaaagtccggcaaggctcagaagagcgtc
gttaagggagataagaaaaagaaggtacgccgcaaggaaagctacgccatctatatttac
aaggtgctgaaacaggtccacccggacaccggagtttcatcgaaggccatgagcatcatg
aacagcttcgtcaacgacatcttcgagcggatcgctgctgaggcttcccgtttggctcat
tacaacaagcgttcgacgataacgtctcgtgaaattcaaaccgctgttcgtttgctgttg
ccgggagaattggccaagcatgccgtctccgagggtaccaaggccgtcaccaagtacacc
agctcaaagtaa

DBGET integrated database retrieval system