KEGG   Arthrobacter arilaitensis: AARI_00860Help
Entry
AARI_00860        CDS       T01320                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
aai  Arthrobacter arilaitensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AARI_00860 (folP)
Enzymes [BR:aai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AARI_00860 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83769..84671
Genome map
AA seq 300 aa AA seqDB search
MSLGAIPGTGPNTSPLPVIRKSSKKTLADLPTGRTLVMGILNVTEDSFSDGGKYLSTDAA
IDQGLKLLYSGADIIDVGGESTRPGARDVDPALESERILPVIETLAKAGAVISVDTMHVS
TARAAIEAGAHIINDVSGLTYEEGMPELIAETGVPYVLMHRRGTAQNMVSEANYADVVAE
VVQELRQLRDEFVAKGVAPEQIIIDPGLGFAKDAQHNWALLANLSAIEELGHRVLIGTSR
KRFLGELLAEGSKSREPLARDAATAATTALGARDKVWAVRVHDVVGSRDAIEVVQAYGSH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttggagcgatcccgggcaccggcccgaacaccagccccttgccagtaatccgc
aagtccagcaagaagaccttggcagacctgcccaccgggcgcaccttggtcatgggcatc
ttgaacgtcaccgaggactccttctccgatggcgggaagtacctgtccaccgatgccgcg
atcgaccaggggctgaagctgctgtactccggcgcggacatcatcgatgtgggcggggaa
tccacccgtcccggtgcaagggacgtggatccggcactggaaagcgaacgcatcctgccg
gtcatcgaaacgctggccaaggccggtgcggtgatctccgtggacaccatgcacgtgtcg
accgcgcgggcggccatcgaagccggcgcgcacatcatcaacgacgtctcgggcctgacc
tatgaagagggcatgccggagctgatcgcagagaccggtgttccctacgtcctgatgcac
cgccgcggcaccgcacagaacatggtgtccgaagcgaactacgccgacgttgtcgccgag
gtagtccaggaactgcgccagctgcgcgatgaattcgtcgccaagggcgtggcacccgag
cagatcatcatcgacccgggactgggctttgccaaggatgcgcagcacaactgggcattg
ctggccaacctttcggccatcgaggagctgggccaccgcgttctgatcggcactagccgc
aagcgcttcctgggcgagctgctggccgagggctccaagagccgcgaaccgctggcccgc
gatgcggccaccgcagcgactaccgcgctgggcgcccgtgacaaggtctgggcagtgcgc
gtgcacgatgtggtgggcagccgcgacgccattgaagtcgtgcaggcttatggatcgcat
tag

DBGET integrated database retrieval system