KEGG   Arthrobacter arilaitensis: AARI_00860Help
Entry
AARI_00860        CDS       T01320                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
aai  Arthrobacter arilaitensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aai00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83769..84671
Genome map
AA seq 300 aa AA seqDB search
MSLGAIPGTGPNTSPLPVIRKSSKKTLADLPTGRTLVMGILNVTEDSFSDGGKYLSTDAA
IDQGLKLLYSGADIIDVGGESTRPGARDVDPALESERILPVIETLAKAGAVISVDTMHVS
TARAAIEAGAHIINDVSGLTYEEGMPELIAETGVPYVLMHRRGTAQNMVSEANYADVVAE
VVQELRQLRDEFVAKGVAPEQIIIDPGLGFAKDAQHNWALLANLSAIEELGHRVLIGTSR
KRFLGELLAEGSKSREPLARDAATAATTALGARDKVWAVRVHDVVGSRDAIEVVQAYGSH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttggagcgatcccgggcaccggcccgaacaccagccccttgccagtaatccgc
aagtccagcaagaagaccttggcagacctgcccaccgggcgcaccttggtcatgggcatc
ttgaacgtcaccgaggactccttctccgatggcgggaagtacctgtccaccgatgccgcg
atcgaccaggggctgaagctgctgtactccggcgcggacatcatcgatgtgggcggggaa
tccacccgtcccggtgcaagggacgtggatccggcactggaaagcgaacgcatcctgccg
gtcatcgaaacgctggccaaggccggtgcggtgatctccgtggacaccatgcacgtgtcg
accgcgcgggcggccatcgaagccggcgcgcacatcatcaacgacgtctcgggcctgacc
tatgaagagggcatgccggagctgatcgcagagaccggtgttccctacgtcctgatgcac
cgccgcggcaccgcacagaacatggtgtccgaagcgaactacgccgacgttgtcgccgag
gtagtccaggaactgcgccagctgcgcgatgaattcgtcgccaagggcgtggcacccgag
cagatcatcatcgacccgggactgggctttgccaaggatgcgcagcacaactgggcattg
ctggccaacctttcggccatcgaggagctgggccaccgcgttctgatcggcactagccgc
aagcgcttcctgggcgagctgctggccgagggctccaagagccgcgaaccgctggcccgc
gatgcggccaccgcagcgactaccgcgctgggcgcccgtgacaaggtctgggcagtgcgc
gtgcacgatgtggtgggcagccgcgacgccattgaagtcgtgcaggcttatggatcgcat
tag

DBGET integrated database retrieval system