KEGG   Arthrobacter arilaitensis: AARI_00870Help
Entry
AARI_00870        CDS       T01320                                 

Gene name
folBK
Definition
bifunctional dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
aai  Arthrobacter arilaitensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aai00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84658..85491
Genome map
AA seq 277 aa AA seqDB search
MDRISVCGISATGYHGVFDHEKRDGQKFIIDVVLHVDISRAAASDNVLDTVHYGEVSELV
VQQIQSGPWDLIEKLGSEIAEAILAAYPSVYTIDVVVHKPQAPIPVPFTDVTISLTRHQK
QHTAIIALGANLGDPQATLAAAVQELGADVELLKVSPLAITKPVGGPPEQPDYTNQVVQV
RTGLSPHELLDLCQSIEAKHHRTREVRWEARTLDLDLIAYDHLRMDDERLTLPHPRAAIR
GFVLAPWSWMDPDAVLDGQLVSRLAAEAADTKDIIRL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattagcgtctgcggaatttcggccaccggctaccatggcgtattcgaccat
gagaaacgcgatggccagaaattcatcatcgacgtggtgctgcatgtggatatttcacgt
gcagcagccagcgacaacgtccttgacaccgtgcactatggcgaagtcagcgaactggta
gtccagcagatccagtcaggtccgtgggatctgatcgagaagctgggcagtgaaatcgcc
gaggcgatcctcgcagcctacccgagcgtttacaccattgacgtcgtggtgcataagccg
caggcacccatcccggtaccgttcaccgatgtcaccatttcgctgacccggcaccagaag
cagcacaccgcgatcatcgcgttgggcgccaacctgggcgatccgcaggccaccttggcc
gccgcggtgcaggagctgggcgccgatgtcgagctgctcaaggtttccccgctggccatc
accaagccggtgggcggcccgccagaacagccggactacaccaaccaggtagtccaggtg
cgcaccgggttgagcccgcatgaactgctggatctgtgccagagcatcgaagccaagcac
caccgcacccgcgaagtgcgctgggaggcgcgcaccctggatctggatctgatcgcctac
gaccatctgcgcatggacgatgagcgactgaccctgcctcatccgcgcgccgcgattcgc
ggattcgtcctggctccgtggagctggatggatccggacgccgtgctcgatggccaattg
gtttcccggctggccgctgaagccgccgacacgaaggacatcatccggctatga

DBGET integrated database retrieval system