KEGG   Arthrobacter arilaitensis: AARI_01380Help
Entry
AARI_01380        CDS       T01320                                 

Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AARI_01380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_01380
  Lipid metabolism
   00071 Fatty acid degradation
    AARI_01380
  Amino acid metabolism
   00350 Tyrosine metabolism
    AARI_01380
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AARI_01380
   00626 Naphthalene degradation
    AARI_01380
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AARI_01380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
143767..144798
Genome map
AA seq 343 aa AA seqDB search
MSKMKAAIVEGFGEEFQVKDAEIPEPGPGQVLVKLIASGVCHTDLHAAEGDWPVKPKLPL
IPGHEGVGIVEKLGEGVTEVALGDMIGNAWLASACGHCQYCRTGWETLCEAQSNGGYSVD
GSFGQYMLVDSRYAAHIPEGSDPHEIAPVLCAGVTVYKGLKMTEVKPGQWVAISGIGGLG
HIAVQYAVAMGMRVIAIDVADDKLALASKHGAEITVNAFAQDPAEIIQQKVGGTHGVLVT
AVHPKAFGQAIGMTRRGGTIVFNGLPAGDFPAPIFDIVLKGLTIRGSIVGTRQDMIEALE
FYAAGKIKPTFHTRPLEDINAVFDEMRHGKIDGRVVIDYAGRA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatgaaagctgcaatagtcgaaggcttcggcgaagagttccaggtgaaggac
gccgagatccctgagcccggccccggccaggtgctggtgaagctgatcgcctcgggcgtc
tgccacaccgacctgcacgccgccgagggcgattggccggtcaagccgaagcttccgctg
attcccgggcatgaaggcgtgggcatcgtggaaaagctcggcgaaggagtcaccgaggtc
gcgctcggggacatgatcggcaacgcgtggctggccagcgcctgcgggcactgccagtac
tgccgcaccggctgggagacgctgtgcgaagcccagtccaatggcggatactccgtggac
ggttccttcggccagtacatgctggtggattcccgctatgccgcgcacatcccggagggc
tcggatccccatgaaatcgcgccggtgctgtgcgcgggagtgactgtctacaagggcctg
aagatgactgaggtcaagcccggccagtgggtggctatttcgggtatcggcggactgggc
catatcgcggtgcagtacgcggtggccatgggcatgcgggtgatcgccattgacgtggcc
gatgacaagctggcgctggcctcgaagcatggagcggaaatcaccgtcaatgccttcgcc
caggacccggccgagatcatccagcagaaggttggcggaacgcacggcgtgctggttacg
gcggtgcatccaaaggcgttcgggcaagcgatcggcatgacccggcgcggcggaacgatc
gtgttcaacgggctgcccgccggtgatttccccgcacccattttcgacatcgtgctcaag
ggcctgaccatccgcggatcgatcgtgggaacacggcaggacatgatcgaggcgctggaa
ttctatgcggcagggaagatcaagccgaccttccatacccgcccgctggaagacatcaac
gccgtattcgacgaaatgcgccatggcaagatcgatgggcgcgttgtcatcgactatgcc
ggcagggcgtag

DBGET integrated database retrieval system