KEGG   Arthrobacter arilaitensis: AARI_01380Help
Entry
AARI_01380        CDS       T01320                                 

Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:aai01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aai00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:aai00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:aai00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:aai00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:aai00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
143767..144798
Genome map
AA seq 343 aa AA seqDB search
MSKMKAAIVEGFGEEFQVKDAEIPEPGPGQVLVKLIASGVCHTDLHAAEGDWPVKPKLPL
IPGHEGVGIVEKLGEGVTEVALGDMIGNAWLASACGHCQYCRTGWETLCEAQSNGGYSVD
GSFGQYMLVDSRYAAHIPEGSDPHEIAPVLCAGVTVYKGLKMTEVKPGQWVAISGIGGLG
HIAVQYAVAMGMRVIAIDVADDKLALASKHGAEITVNAFAQDPAEIIQQKVGGTHGVLVT
AVHPKAFGQAIGMTRRGGTIVFNGLPAGDFPAPIFDIVLKGLTIRGSIVGTRQDMIEALE
FYAAGKIKPTFHTRPLEDINAVFDEMRHGKIDGRVVIDYAGRA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatgaaagctgcaatagtcgaaggcttcggcgaagagttccaggtgaaggac
gccgagatccctgagcccggccccggccaggtgctggtgaagctgatcgcctcgggcgtc
tgccacaccgacctgcacgccgccgagggcgattggccggtcaagccgaagcttccgctg
attcccgggcatgaaggcgtgggcatcgtggaaaagctcggcgaaggagtcaccgaggtc
gcgctcggggacatgatcggcaacgcgtggctggccagcgcctgcgggcactgccagtac
tgccgcaccggctgggagacgctgtgcgaagcccagtccaatggcggatactccgtggac
ggttccttcggccagtacatgctggtggattcccgctatgccgcgcacatcccggagggc
tcggatccccatgaaatcgcgccggtgctgtgcgcgggagtgactgtctacaagggcctg
aagatgactgaggtcaagcccggccagtgggtggctatttcgggtatcggcggactgggc
catatcgcggtgcagtacgcggtggccatgggcatgcgggtgatcgccattgacgtggcc
gatgacaagctggcgctggcctcgaagcatggagcggaaatcaccgtcaatgccttcgcc
caggacccggccgagatcatccagcagaaggttggcggaacgcacggcgtgctggttacg
gcggtgcatccaaaggcgttcgggcaagcgatcggcatgacccggcgcggcggaacgatc
gtgttcaacgggctgcccgccggtgatttccccgcacccattttcgacatcgtgctcaag
ggcctgaccatccgcggatcgatcgtgggaacacggcaggacatgatcgaggcgctggaa
ttctatgcggcagggaagatcaagccgaccttccatacccgcccgctggaagacatcaac
gccgtattcgacgaaatgcgccatggcaagatcgatgggcgcgttgtcatcgactatgcc
ggcagggcgtag

DBGET integrated database retrieval system