KEGG   Glutamicibacter arilaitensis Re117: AARI_01380Help
Entry
AARI_01380        CDS       T01320                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00010  Glycolysis / Gluconeogenesis
aai00071  Fatty acid degradation
aai00350  Tyrosine metabolism
aai00625  Chloroalkane and chloroalkene degradation
aai00626  Naphthalene degradation
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01120  Microbial metabolism in diverse environments
aai01130  Biosynthesis of antibiotics
aai01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_01380
  Lipid metabolism
   00071 Fatty acid degradation
    AARI_01380
  Amino acid metabolism
   00350 Tyrosine metabolism
    AARI_01380
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AARI_01380
   00626 Naphthalene degradation
    AARI_01380
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AARI_01380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C ELFV_dehydrog adh_short ThiF
Motif
Other DBs
NCBI-ProteinID: CBT74377
UniProt: E1VRX4
Position
143767..144798
Genome map
AA seq 343 aa AA seqDB search
MSKMKAAIVEGFGEEFQVKDAEIPEPGPGQVLVKLIASGVCHTDLHAAEGDWPVKPKLPL
IPGHEGVGIVEKLGEGVTEVALGDMIGNAWLASACGHCQYCRTGWETLCEAQSNGGYSVD
GSFGQYMLVDSRYAAHIPEGSDPHEIAPVLCAGVTVYKGLKMTEVKPGQWVAISGIGGLG
HIAVQYAVAMGMRVIAIDVADDKLALASKHGAEITVNAFAQDPAEIIQQKVGGTHGVLVT
AVHPKAFGQAIGMTRRGGTIVFNGLPAGDFPAPIFDIVLKGLTIRGSIVGTRQDMIEALE
FYAAGKIKPTFHTRPLEDINAVFDEMRHGKIDGRVVIDYAGRA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatgaaagctgcaatagtcgaaggcttcggcgaagagttccaggtgaaggac
gccgagatccctgagcccggccccggccaggtgctggtgaagctgatcgcctcgggcgtc
tgccacaccgacctgcacgccgccgagggcgattggccggtcaagccgaagcttccgctg
attcccgggcatgaaggcgtgggcatcgtggaaaagctcggcgaaggagtcaccgaggtc
gcgctcggggacatgatcggcaacgcgtggctggccagcgcctgcgggcactgccagtac
tgccgcaccggctgggagacgctgtgcgaagcccagtccaatggcggatactccgtggac
ggttccttcggccagtacatgctggtggattcccgctatgccgcgcacatcccggagggc
tcggatccccatgaaatcgcgccggtgctgtgcgcgggagtgactgtctacaagggcctg
aagatgactgaggtcaagcccggccagtgggtggctatttcgggtatcggcggactgggc
catatcgcggtgcagtacgcggtggccatgggcatgcgggtgatcgccattgacgtggcc
gatgacaagctggcgctggcctcgaagcatggagcggaaatcaccgtcaatgccttcgcc
caggacccggccgagatcatccagcagaaggttggcggaacgcacggcgtgctggttacg
gcggtgcatccaaaggcgttcgggcaagcgatcggcatgacccggcgcggcggaacgatc
gtgttcaacgggctgcccgccggtgatttccccgcacccattttcgacatcgtgctcaag
ggcctgaccatccgcggatcgatcgtgggaacacggcaggacatgatcgaggcgctggaa
ttctatgcggcagggaagatcaagccgaccttccatacccgcccgctggaagacatcaac
gccgtattcgacgaaatgcgccatggcaagatcgatgggcgcgttgtcatcgactatgcc
ggcagggcgtag

DBGET integrated database retrieval system