KEGG   Arthrobacter arilaitensis: AARI_03110Help
Entry
AARI_03110        CDS       T01320                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aai  Arthrobacter arilaitensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AARI_03110
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AARI_03110
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AARI_03110
Enzymes [BR:aai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AARI_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333732..335339
Genome map
AA seq 535 aa AA seqDB search
MTSISRRKLLTGTLGASALTLVGPTGAALASSSPRLVRSRLGLTSGFSMGDVSTSNAVFW
ARSSGEGRLRAQLRAVDETGNIIRGRGSFAKTLRGAYARETTDFTAKINAQHLPAGTRFA
VSIGFEDENGTLGEMQNGWFSTAPALTGRRNQDASRAQSFVWSGDTAGQGWGINEEIGRM
RAYAAMHATKPDFFVHSGDTIYADGPIAGEVMEPDGQIWRNLVTEEVSKVAETLDEYRGR
HRYNLMDHNVRAMYAEVPVIAQWDDHETHNNWWPGEVIQDERYTVRDINTLAARGRQAWQ
EYQPIADPRAMNGGTGFEAARIYRKISRGPVLDLFALDMRSYKSENTAGMEEKATAILGE
EQLNWLVDGLAKSKATWKVILNDLPLGIIVPDGKAQESISNADHGAPLGRELELARLLKA
IKDRGIKNVVFLTADVHYCAAHHYSPERAAFREFNEFWEFVAGPVNAGSFGPNEMDGTFG
PKVEFSKAGTTNQSPRDGKGQFFGHVDLDEQDLFTVTLRNGLGETVYTKTLEPAK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgactagtatttcgcgtcgcaaattgctcaccggtacgctcggtgcaagcgccctaacc
ctggtcgggccgactggagcagcgctggcatccagcagcccccgtctagtgcgttcccga
cttggcctgaccagcgggttttccatgggtgatgtctccaccagcaatgccgtgttctgg
gcccgcagctccggcgagggccgcttgcgtgctcaactgcgcgcggtagacgaaactgga
aatatcatccggggccgcggatcattcgccaagactttgcgcggcgcctacgcccgcgag
accaccgacttcactgcaaagatcaatgcccagcatctgcctgccgggacgcgcttcgcc
gtcagtatcggcttcgaagacgaaaacggaaccctgggcgagatgcagaacggctggttc
agcaccgcacctgcactgaccggtcgccgcaatcaagatgcctcccgggcccagagcttt
gtctggtccggcgatacggctggccagggctggggcatcaatgaagaaatcggcagaatg
cgcgcctacgcggccatgcatgcgacaaagccggatttcttcgtgcacagcggcgacacg
atatatgccgacggcccgattgccggggaggtcatggaacctgacggccagatttggcgc
aacctggtcaccgaagaagtctccaaggtggccgaaaccctggacgagtaccgcggccgg
caccgctacaacctgatggaccacaacgtgcgggccatgtatgccgaagttccggtgatt
gcccagtgggatgaccacgaaacccacaacaactggtggccaggcgaggttatccaagat
gagcgctacaccgtgcgcgatatcaacacattggctgctcgcggccgccaggcctggcag
gaataccagccgatcgccgacccgcgcgccatgaacggcggcaccggattcgaggctgcc
cgcatctaccgcaaaatctcccgaggcccggtactggacctcttcgcgctggacatgcgc
agctacaagtcggagaacaccgccggaatggaagagaaggccaccgcgatcctcggcgag
gaacagctgaactggctggtggacgggctggccaagtccaaggccacctggaaggtcatc
ctcaacgatctgccgctgggcatcattgttcccgatggcaaggcccaggaatccatttcc
aatgcagaccacggcgcaccactaggccgcgaactggaactggcgcgattgctcaaggcc
atcaaggatcgcggcatcaagaatgtggtcttcctgactgccgacgtgcactactgcgcg
gcccaccactattcgccagagcgcgccgccttccgcgagttcaacgagttctgggaattc
gtggccggcccggtcaacgccggttccttcgggccaaatgaaatggatggcaccttcggc
ccgaaggtcgagttctccaaggccggtaccaccaaccagtcgcctcgcgatggcaagggg
cagttcttcggccatgttgatttggacgagcaggatctgttcaccgtgactttgcgcaac
gggctgggcgaaaccgtctacaccaagacgctggaacctgccaagtag

DBGET integrated database retrieval system