KEGG   Arthrobacter arilaitensis: AARI_03170Help
Entry
AARI_03170        CDS       T01320                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
aai  Arthrobacter arilaitensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AARI_03170 (recR)
DNA repair and recombination proteins [BR:aai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AARI_03170 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(340137..340949)
Genome map
AA seq 270 aa AA seqDB search
MYEGAVQELIDELGRLPGIGPKSAQRIAFHILDADAEDMTRLAASIQLVKEKVKFCEICF
NISEQEICAICRDERRDGTKICIVEESKDVLAIERTRAFSGKYHVLGGSINPLAGIGPEQ
LHIRELVTRLADDSITELILATDPNLEGEATAVYLVRALAPLGIHITRLASGLPVGGDLE
YADEVTLARAFEGRRAAGRTAPGPARLKAEKQEATEKDEQEESEDPAQKPKAQLPEPRLL
HVGGKPVDSGTGCEASSHPVVPEMDNRRSQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggtgctgtacaggaactgatcgacgagctcggtcgcttgcctggcatcggc
ccgaaatcggctcagcgcattgctttccacattcttgatgccgatgccgaggacatgacc
cggctggccgcctcgatccagctggtcaaggaaaaggtgaagttctgcgagatctgcttc
aacatctcggagcaggaaatctgcgccatctgccgcgatgagcgtcgcgatggaaccaag
atctgcatcgtcgaagagtccaaggacgtgctggccattgaacgcacccgcgcgttctcc
ggcaagtaccacgtgctgggcggctccatcaatccactagcgggcatcggtccggaacag
cttcacatccgcgaactggttacgcgcttggccgatgattcgatcaccgaattgatccta
gccactgaccctaaccttgagggcgaagccaccgccgtgtacctggtgcgtgctctggct
cccctgggtattcacatcacccgcttggcttctggcctgccggttggcggcgacttggag
tacgccgatgaggtgactttggctcgtgccttcgaaggacgccgcgccgctggccgcacc
gctccggggccggcccggctcaaggccgaaaagcaggaggccacggagaaggatgagcag
gaagaatccgaagatcctgcacagaagcccaaggcccagcttcccgagccacgcctgctg
cacgttggcggcaagccggttgattccggcaccgggtgtgaggcttcttcgcatcctgtg
gttcccgagatggataaccgccgcagccaataa

DBGET integrated database retrieval system