KEGG   Arthrobacter arilaitensis: AARI_03520Help
Entry
AARI_03520        CDS       T01320                                 

Definition
glycosyl hydrolase family 3 protein (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aai  Arthrobacter arilaitensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AARI_03520
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AARI_03520
Enzymes [BR:aai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AARI_03520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379788..381107
Genome map
AA seq 439 aa AA seqDB search
MTTRAKQLLSAGMLMTLMLASCSAPNAGKPAPSTPTTSVNISSGPTAPAQPTAPSQTSAS
SSHLDTMPTQSQQPSPREQAEALANELSVSEQASSLVMAGVPATGASAAEISALKKQGIS
NVFLRGRSQLSVKQTSVKVQQITQSLEANVPADLPVWVATDQEGGFVRVQQGPGFTELPT
ALTQGGWSPSKLKRELGAVGKQLVEAGINVNLAPVADVVPAELGTGNAPIGYFGREYAHG
ATAVAKTMATVNEALHSQGVQPVVKHFPGLGRVAKNTDTNSGVADTKIDANSSDLQPFER
AIEQDKSWVMVSNARYAKLDAKNDAPFSSKIITGLLREQMGYEGIVISDDLCEAKQVSYL
QVGERAVKFVAAGGTLPLCVESAPAITMAKALAAEAKADGKFAAKVKEAAVKILEEKLSA
RQAARRQIKRVGPGCFLTR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacgtgccaagcagctcttgtcagccggaatgctgatgacgctgatgctcgct
agctgcagtgcgccgaatgcaggaaaaccggctccgagcacgccaacgaccagtgtcaac
atctccagtggtccgacggctcctgcgcagccaactgctcccagccagaccagcgcatct
agcagccacctcgacacgatgcccacgcagagccagcaaccttcaccgcgtgagcaagcc
gaagcattggcaaacgaactaagcgtcagcgaacaggcttccagcctcgtgatggctggt
gtcccggcgacgggagcgagtgcagctgaaatttctgcgctgaagaaacagggaatttcc
aatgtgttcctgcgcgggcgctcgcagttgtctgtgaaacagacttccgtcaaggttcag
caaattacgcagagcttggaagccaacgtgccggcggacttgccggtatgggtggctacc
gaccaagaaggtggttttgttcgggtgcagcagggcccgggtttcaccgaactgccaacc
gcgttgacgcagggaggctggtccccctcgaagctgaaacgtgagctcggcgcagtgggc
aagcagctggttgaggcgggcattaacgtgaacctggctccggtggctgatgtggttcct
gccgaactcggcaccggcaatgcgcctatcggctactttggccgcgaatacgcccacggt
gccaccgcggttgccaaaacgatggcaacagtgaatgaagcgcttcattcccaaggagtg
cagccggtggtcaagcacttccccgggctgggccgtgtcgccaaaaacaccgataccaat
agcggggtggccgatacgaaaattgatgcgaactccagtgatctgcagcccttcgaacgg
gctatcgagcaggacaaatcgtgggtcatggtttccaacgcccgctatgccaaattagat
gcgaaaaacgatgcaccgttttcatcgaagatcattaccggcttgctgcgcgagcaaatg
ggatacgagggaatcgtgatttctgatgacctctgtgaagccaagcaggtgagttatctt
caggtgggcgagcgtgcagtgaagttcgttgccgctggcggaaccttgcctttatgcgtg
gaatcagctccggcgatcaccatggcgaaggctctggctgccgaggctaaagcagatggg
aaattcgcggccaaggtaaaagaagccgccgtgaagatcctcgaggagaagctcagcgca
cgccaagccgcacggagacaaattaaaagagtaggcccgggatgcttccttactcgctag

DBGET integrated database retrieval system