KEGG   Glutamicibacter arilaitensis Re117: AARI_05230Help
Entry
AARI_05230        CDS       T01320                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00010  Glycolysis / Gluconeogenesis
aai00260  Glycine, serine and threonine metabolism
aai00680  Methane metabolism
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01120  Microbial metabolism in diverse environments
aai01130  Biosynthesis of antibiotics
aai01200  Carbon metabolism
aai01230  Biosynthesis of amino acids
Module
aai_M00002  Glycolysis, core module involving three-carbon compounds
aai_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_05230 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AARI_05230 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AARI_05230 (gpmA)
Enzymes [BR:aai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AARI_05230 (gpmA)
Membrane trafficking [BR:aai04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AARI_05230 (gpmA)
Exosome [BR:aai04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AARI_05230 (gpmA)
  Exosomal proteins of melanoma cells
   AARI_05230 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBT74750
UniProt: E1VSZ7
Position
567935..568681
Genome map
AA seq 248 aa AA seqDB search
MSHTLILLRHGQSEWNEKNLFTGWYDVSLTEKGRAEAARGGQLLTEAGYKPEVLHTSLLT
RAIVTANLALEAAGRSWIPVNRDWRLNERHYGALQGKDKAQTLAEFGEEQFMEWRRSYDT
PPPALDDSSEFSQINDERYAALGDSAPRTECLKDVLDRMLPYWENNIKADLSAGKTVMVT
AHGNSLRALVKHLDGISDEDIAGLNIPTGIPLVYELDDNFQPITRGGTYLDPEAAADAIK
AVANQGRK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagccacactttgattttgcttcgccacggacagagcgaatggaacgaaaagaacctg
tttaccggttggtacgacgtatcgctgaccgagaagggccgtgccgaagctgcacgcggc
ggccagctgctgaccgaagcgggctacaagcctgaggtgcttcacacctcgttgctgacc
cgcgcgattgttaccgcaaacctggcattggaggccgctggccgatcgtggatcccagtg
aaccgcgactggcgcctgaacgagcgccactacggtgcgctgcagggcaaggacaaggcg
cagaccttggccgaattcggcgaagagcagttcatggaatggcgccgcagctacgacacc
ccgccaccagcactggatgattcctcggaattcagccagatcaacgatgagcgctatgca
gcgttgggcgattccgctccacgcaccgagtgcctcaaggatgtactggaccgcatgctt
ccgtactgggagaacaacatcaaggctgatctgtcggcaggcaagaccgtgatggtcacc
gcccacggcaactcgctgcgtgcgctggtcaagcatttggatggcatcagcgatgaagac
attgctggtctgaacatccctaccggcattccgctggtctatgagttggatgacaacttc
cagccaatcaccaggggcggaacctacttggatccagaggctgctgccgacgctattaag
gccgtcgccaaccagggacgcaagtaa

DBGET integrated database retrieval system