KEGG   Arthrobacter arilaitensis: AARI_05230Help
Entry
AARI_05230        CDS       T01320                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aai  Arthrobacter arilaitensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AARI_05230 (gpmA)
   01230 Biosynthesis of amino acids
    AARI_05230 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AARI_05230 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AARI_05230 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AARI_05230 (gpmA)
Enzymes [BR:aai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AARI_05230 (gpmA)
Exosome [BR:aai04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AARI_05230 (gpmA)
  Exosomal proteins of melanoma cells
   AARI_05230 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
567935..568681
Genome map
AA seq 248 aa AA seqDB search
MSHTLILLRHGQSEWNEKNLFTGWYDVSLTEKGRAEAARGGQLLTEAGYKPEVLHTSLLT
RAIVTANLALEAAGRSWIPVNRDWRLNERHYGALQGKDKAQTLAEFGEEQFMEWRRSYDT
PPPALDDSSEFSQINDERYAALGDSAPRTECLKDVLDRMLPYWENNIKADLSAGKTVMVT
AHGNSLRALVKHLDGISDEDIAGLNIPTGIPLVYELDDNFQPITRGGTYLDPEAAADAIK
AVANQGRK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagccacactttgattttgcttcgccacggacagagcgaatggaacgaaaagaacctg
tttaccggttggtacgacgtatcgctgaccgagaagggccgtgccgaagctgcacgcggc
ggccagctgctgaccgaagcgggctacaagcctgaggtgcttcacacctcgttgctgacc
cgcgcgattgttaccgcaaacctggcattggaggccgctggccgatcgtggatcccagtg
aaccgcgactggcgcctgaacgagcgccactacggtgcgctgcagggcaaggacaaggcg
cagaccttggccgaattcggcgaagagcagttcatggaatggcgccgcagctacgacacc
ccgccaccagcactggatgattcctcggaattcagccagatcaacgatgagcgctatgca
gcgttgggcgattccgctccacgcaccgagtgcctcaaggatgtactggaccgcatgctt
ccgtactgggagaacaacatcaaggctgatctgtcggcaggcaagaccgtgatggtcacc
gcccacggcaactcgctgcgtgcgctggtcaagcatttggatggcatcagcgatgaagac
attgctggtctgaacatccctaccggcattccgctggtctatgagttggatgacaacttc
cagccaatcaccaggggcggaacctacttggatccagaggctgctgccgacgctattaag
gccgtcgccaaccagggacgcaagtaa

DBGET integrated database retrieval system