KEGG   Arthrobacter arilaitensis: AARI_05810Help
Entry
AARI_05810        CDS       T01320                                 

Gene name
gbh
Definition
guanidinobutyrase (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
aai  Arthrobacter arilaitensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AARI_05810 (gbh)
Enzymes [BR:aai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AARI_05810 (gbh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645052..646038
Genome map
AA seq 328 aa AA seqDB search
MKEIRIEENGRLGPINAAMIPRYAGGGTYARLPRLDQVEKADIKIVGVPFDTGVSYRPGA
RFGANHVRESSRLIRPYNPATDTSPFAQSQVADAGDMAVNPFNINEAIETIEHEALELTS
DGSTLVTVGGDHTIALPLLRAASQRAGAPVAMLHFDAHLDTWDTYFGAEYTHGTPFRRAV
EEGILDTEAICHVGTRGPLYGKKDLEDDKRFGFGIVTSSDVYYQGVREIVDKLRDRIGNR
PLYISVDIDVLDPAHAPGTGTPEAGGITSRELLEILRGLRGLNIVGADIVEVAPAYDHAE
LTGVAASHVTYDLISLISDFRASKGMNS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaatccgtatcgaggaaaatggtcgtctagggcccatcaatgctgcgatgatt
ccgcgctatgcaggaggcggcacctatgcccggcttccacgactggaccaagtggagaaa
gccgacatcaagattgtcggagtgccgtttgataccggtgtttcctatcgtcccggtgcc
cgctttggtgccaaccacgtacgtgaatcctcgcgcctgatccgcccctacaacccggcg
acagatacctcgccgtttgcgcagagccaggtggctgacgcaggggacatggcggttaac
ccgttcaatatcaatgaggccattgaaaccattgaacacgaggcactggaactgaccagc
gatggctccaccctcgtcaccgttggtggcgaccacaccatcgcgctgcccttgctgcgt
gccgcttcgcagcgcgctggagcaccagttgccatgctgcacttcgatgcgcacctggat
acgtgggatacctacttcggcgctgaatatacgcacggcactccgttccgccgtgctgtt
gaagaaggcattttggacaccgaagcaatctgccatgtcggcacccgcggtccgctatac
ggcaaaaaagacttggaagatgacaagcgtttcggctttggcatcgtgaccagctccgat
gtctactaccagggcgtacgtgaaatcgtggacaaactgcgcgatcgcattggcaatcgc
ccactgtacatttcggtggacatcgacgtgcttgacccggctcacgccccgggcaccggc
accccggaagccggcggcatcaccagccgcgaattgcttgaaatcctgcgcggtttgcgt
gggctgaacatcgttggtgcagatatcgttgaagtcgctccggcctatgaccatgcagag
ctgaccggtgtggcggcctcgcatgtcacctatgatttgatcagcctgatcagcgacttc
cgtgccagtaagggaatgaatagctaa

DBGET integrated database retrieval system